Identifiers and Description

Gene Model Identifier

TTHERM_00661640

Standard Name

GST33 (Glutathione S-transferase mu 33, TtGSTm33, GSTm33)

Aliases

PreTt23809 | 98.m00152 | 3736.m00052

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00661640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17214.11.0000198575659891e-106glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig16299.0.g152.000130478826482e-26Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_314820.000000000000001713908431542013
DictyBaseDDB_G02740810.00000000030007160092483236DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017530.00000019998969434520019locus:gst-5 Probable glutath
ione S-transferase 5 status:
Confirmed UniProt:Q09596 p
rotein_id:CAA86859.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00661640(coding)
ATGATTACTCTTGGCTACTGGAATGCTAGAGGATTAGGATAGTCTATCCGTTTCTTACTT
GCCTATTTAGGTGTAGAATATACTAATAAGGCATACAGCACACCAGAAGAATGGTTTGGT
AAAGATAAAAATAACTTAGGTTTAGAATTTCCAAATCTTCCTTATATTATCGATGGGGAA
TTTAAGCTTACTGAATCTTAAGCAATTCCTATCTATCTACTCAAGAAATACAAAAGAGTC
GATTTATTAGGTTTATCTAATGATGGAAGCAACAGTGAGAGAGAAGTTAGAGTTGCTTAG
CTTACTGGAGTTATCAAAGATATATACAAAGAAACACTTCCAGTATGTTTCAGCCCTGAT
TTCGATAAAATAAAAGATTAAGCTTTTGCTAAGGGTGAAGTTTTACTTAAAAAACTTGTA
AGTTTTCTAGGTGATAAAGAATTTTTGCTCACTACTTTGACTTATGCTGATTTTCTCTTA
TATGAAATACTATGCTATTATAAGTATATTTATCCTTAAGCTATAACTCCTACATTAACA
GCTTATATGAATAGATTTGAGAATTTACCTGGTATTAAATAATACATAGCAAACCCAAAC
ATAAATCTCAAAGCTTTTCTTCCTCCATTCGCTACTTGGTCAGGTCCTCAGTGA


>TTHERM_00661640(protein)
MITLGYWNARGLGQSIRFLLAYLGVEYTNKAYSTPEEWFGKDKNNLGLEFPNLPYIIDGE
FKLTESQAIPIYLLKKYKRVDLLGLSNDGSNSEREVRVAQLTGVIKDIYKETLPVCFSPD
FDKIKDQAFAKGEVLLKKLVSFLGDKEFLLTTLTYADFLLYEILCYYKYIYPQAITPTLT
AYMNRFENLPGIKQYIANPNINLKAFLPPFATWSGPQ


>TTHERM_00661640(gene)
ATGATTACTCTTGGCTACTGGAATGCTAGAGGATTAGGATAGTCTATCCGTTTCTTACTT
GCCTATTTAGGTGTAGAATATACTAATAAGGCATACAGCACACCAGAAGAATGGTTTGGT
AAAGATAAAAATAACTTAGGTTTAGAATTTCCAAATCTTCCTTATATTATCGATGGGGAA
TTTAAGCTTACTGAATCTTAAGCAATTCCTATCTATCTACTCAAGAAATACAAAAGAGTC
GATTTATTAGGTTTATCTAATGATGGAAGCAACAGTGAGAGAGAAGTTAGAGTTGCTTAG
CTTACTGGAGTTATCAAAGATATATACAAAGAAACACTTCCAGTATGTTTCAGCCCTGAT
TTCGATAAAATAAAAGATTAAGCTTTTGCTAAGGGTGAAGTTTTACTTAAAAAACTTGTA
AGTTTTCTAGGTGATAAAGAATTTTTGCTCACTACTTTGACTTATGCTGATTTTCTCTTA
TATGAAATACTATGCTATTATAAGTATATTTATCCTTAAGCTATAACTCCTACATTAACA
GCTTATATGAATAGATTTGAGAATTTACCTGGTATTAAATAATACATAGCAAACCCAAAC
ATAAATCTCAAAGCTTTTCTTCCTCCATTCGCTACTTGGTCAGGTCCTCAGTGA