Identifiers and Description

Gene Model Identifier

TTHERM_00661620

Standard Name

GST32 (Glutathione S-transferase mu 32, TtGSTm32, GSTm32)

Aliases

PreTt23807 | 98.m00150 | 3736.m00050

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00661620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17214.16.999054974866289e-109glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig16299.0.g156.999211576891585e-27Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_298046.305116760146989e-16
DictyBaseDDB_G02835750.0000000029989608248573072DDB_G0283575 on chromosome: 4
position 855359 to 856264
WormBaseWBGene000017490.00000019998969434520019locus:gst-1 Glutathione S-tr
ansferase P status:Confirmed
UniProt:P10299 protein_id
:CAA78471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00661620(coding)
ATGATTACTCTTGGCTACTGGAATGTTAGAGGATTAGGATAGTCTATCCGTTTCTTACTT
GCTTATTTGGGTGTAGAATATAATAGTAAGGTTTATAGCACAGCAGAAGAATGGTTTGGT
AAAGATAAAAATAACTTAGGTTTAGAATTTCCAAATATTCCTTATATTATCGATGGGGAA
TTTAAGCTTACTGAATCTTCAGCCATTCCTATCTATTTACTCAGGAAATACAAAAGAGCT
GATTTATTAGGTTTTTCTAATGATGGAAGCTACAGTGAGAGAGAAGTTAGAGTTGCTCAG
CTTATTGGTGTTATAAAAGATATCTATAAAGAAACAATTCCAGTATGTTTCAGCCCTGAT
TTCGATAAAATAAAAGATTAAGCTTTTGCTAAGGGTGAAGTTTTACTTAAAAAACTTGTA
AGTTTTCTTGGAGATAAAGAGTTTTTGCTTAGTACTTTGACTTATGCTGATTTTCTCTTA
TATGAAGTACTATGCTATTATAAGTATATTTATCCTTAAGCTATAACACCTACACTAACG
GCTTATATGAACAGATTTGAGAATTTACCAGGAATTAAATAGTACATAGCAAACCCAAGC
ATAAATCTCAAAGCTTTCCTTCCTACATTCAAATCTACATGGTCAGGTCCTCAATGA


>TTHERM_00661620(protein)
MITLGYWNVRGLGQSIRFLLAYLGVEYNSKVYSTAEEWFGKDKNNLGLEFPNIPYIIDGE
FKLTESSAIPIYLLRKYKRADLLGFSNDGSYSEREVRVAQLIGVIKDIYKETIPVCFSPD
FDKIKDQAFAKGEVLLKKLVSFLGDKEFLLSTLTYADFLLYEVLCYYKYIYPQAITPTLT
AYMNRFENLPGIKQYIANPSINLKAFLPTFKSTWSGPQ


>TTHERM_00661620(gene)
ATGATTACTCTTGGCTACTGGAATGTTAGAGGATTAGGATAGTCTATCCGTTTCTTACTT
GCTTATTTGGGTGTAGAATATAATAGTAAGGTTTATAGCACAGCAGAAGAATGGTTTGGT
AAAGATAAAAATAACTTAGGTTTAGAATTTCCAAATATTCCTTATATTATCGATGGGGAA
TTTAAGCTTACTGAATCTTCAGCCATTCCTATCTATTTACTCAGGAAATACAAAAGAGCT
GATTTATTAGGTTTTTCTAATGATGGAAGCTACAGTGAGAGAGAAGTTAGAGTTGCTCAG
CTTATTGGTGTTATAAAAGATATCTATAAAGAAACAATTCCAGTATGTTTCAGCCCTGAT
TTCGATAAAATAAAAGATTAAGCTTTTGCTAAGGGTGAAGTTTTACTTAAAAAACTTGTA
AGTTTTCTTGGAGATAAAGAGTTTTTGCTTAGTACTTTGACTTATGCTGATTTTCTCTTA
TATGAAGTACTATGCTATTATAAGTATATTTATCCTTAAGCTATAACACCTACACTAACG
GCTTATATGAACAGATTTGAGAATTTACCAGGAATTAAATAGTACATAGCAAACCCAAGC
ATAAATCTCAAAGCTTTCCTTCCTACATTCAAATCTACATGGTCAGGTCCTCAATGA