Identifiers and Description

Gene Model Identifier

TTHERM_00672290

Standard Name

GST31 (Glutathione S-transferase mu 31, GSTm31, TtGSTm31)

Aliases

PreTt10975 | 101.m00130

Description

GST31 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00628 ) PHD-finger
  • ( PF08043 ) Xin repeat
  • ( PF08746 ) RING-like domain
  • ( TIGR00165 ) ribosomal protein S18
  • ( TIGR00184 ) adenylosuccinate synthetase
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 30.7%

TetraMine Data

TTHERM_00672290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14287.14.998338612125368e-60hypothetical protein (410 aa)
OxytrichaContig11102.0.g1016.997125142158947e-47Ring finger domain
DictyBaseDDB_G02878473.001290106883431e-24DDB_G0287847 on chromosome: 5
position 813389 to 816054
WormBaseWBGene000047683.9989916100764785e-24locus:sel-11 E3 ubiquitin-pr
otein ligase hrd-1 status:Co
nfirmed UniProt:Q20798 pro
tein_id:CAA96657.1
Stentor CoeruleusSteCoe_225196.305116760146989e-16
SGDYOL013C0.000000019990673443141236HRD1 Ubiquitin-protein ligase
required for endoplasmic retic
ulum-associated degradation (E
RAD) of misfolded proteins; ge
netically linked to the unfold
ed protein response (UPR); reg
ulated through association wit
h Hrd3p; contains an H2 ring f
inger

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00672290(coding)
ATGTCTGTTTTAACATTTAAGCATTACAGCTTTTTGAGTATCCTGCTAGCAGGAGGAGCT
ATAATAAATTCTTATACTATTCATGAGCAATTCTATCCTACAATTATTTATCTGACAAAT
CAGAAATCTAATAAATTAATCATGCTCAATTTTTTTTTTATGTTGGGCTTAGCTTTTTTT
AAGATGATAATGTCAGTATTCTTTGGAGAAATCAGAGAGATAGAAAAACTTAGTATTTTA
GATAGTTTAAAGAGAAAGATATTTGATATTGTATTCATCATATTGATTTACAAGGAAGAT
AACTTCGATTCCTCATTTTACTCATGGCTTATTGTTTTAGGATTTATATGGGTGATCCAT
TAAGCAGCAATTAAAAGATCAGAATATCTTATAGCTGAGAGCATAACAGATGTAAAGATG
CACATGAAGTTAACAGTAATTTATATAGCACTGATTTGTTTGGACTCTTGTGTTCTTAGA
TATATGATAAAAGCATTCACAAATACTTCTGTAGATTCTTATTTAATTTTGTTTTTCTTA
GAATATTTACTGATAAGCTTGAATATCATATTTCCTGCAATTAAATACTTTACAATAGCT
TTTGAGATGTTTACATACTCTCATTTCTAAAATAAAAATAACTTCTTCATGGTATTAGAA
TTCGTTTTAACAGTTTGCAAATTGTGTATCTAGCTTTATATGAGAATTAAATACATGCTT
TTATTCCCTTTTATAGTCGACTTGATTGAAAACCTTATCCAGCTTTACAATACAATAGTT
AAATTCTTCTCATCAGTTAAGTTATTAAGGCTCTTAAACAAATTACCTGATGTTAACTTG
GAGGAAATAGAAGAAATAGATAACACCTGCTTGATCTGCTTATCAGAAATTAAGCATGGA
AAAAAGATTGGATGTGGTCACTTTTTCCACAAAAACTGTTTAAAAGAGTTAATTTAAGGA
AAGTCAAATCAACTTTGTCCTAAATGCAGAAGCCCCATCAATATTGAGCAAGCCATTAAA
GATCATCAAAATGAATCAAAAAATTAAAAAAAGAAAAATTCTGAAGCTATTTTCAAAATA
AATTTTATTAAGAGCTAGAAAGATTCAGGAGAATAAAAAGACAGTAAAAATTAAGAATAA
TAAACTGAGTCTAAGAGATTTAAGTTTATAGAAAATGCAACCATCTAAGAAAAAATTATT
TTCACTCTAGATGATCTTATTAATAACATTGGTAATATGATTAAATCTTAAATCAACGAA
CCTAAGATCATTTAGAGAGTTAAAGGCTTAATTTAAGATATCTTAAAACTTGAAGAATTG
ATTTAAACAAATGAATAAAAGAAATTAAAAGTAGAACTTAATCTGGAAAATATTTTTGAT
TTTAGTTAATTGCTTGCTAGCACAAACACTTCTTTGAAAAAATGTGGTGCTATTTCTTAT
GGACTGCCGAAAATAGCTAGCTACAACCGTACTTTTGCTGATGAGTGTCTGAGAAAAAAG
ATTGAATTGATGAATTTATTGCTTTTGAACTGCTAAAGAGATATGTTACTATAAACAATG
TTCTTTGGGATTACTAAGAATTTGACTAACCTAAAACAAGACGAAAGTGAAAATTATTAA
TAAGAACAAAAAGGTTCTCATTAGACTAATGATGGTTTATTTAAGACTTAAAGTTTGAAC
AATAATAATAATTCTTCGCTTGCTGGTGAAACAAAAAAATTACAAAAGATATTAGTTAGT
TAACAATAAAACTAAAATGAAAATTAATAAGATGCTCTAGCCTCTAACTGA


>TTHERM_00672290(protein)
MSVLTFKHYSFLSILLAGGAIINSYTIHEQFYPTIIYLTNQKSNKLIMLNFFFMLGLAFF
KMIMSVFFGEIREIEKLSILDSLKRKIFDIVFIILIYKEDNFDSSFYSWLIVLGFIWVIH
QAAIKRSEYLIAESITDVKMHMKLTVIYIALICLDSCVLRYMIKAFTNTSVDSYLILFFL
EYLLISLNIIFPAIKYFTIAFEMFTYSHFQNKNNFFMVLEFVLTVCKLCIQLYMRIKYML
LFPFIVDLIENLIQLYNTIVKFFSSVKLLRLLNKLPDVNLEEIEEIDNTCLICLSEIKHG
KKIGCGHFFHKNCLKELIQGKSNQLCPKCRSPINIEQAIKDHQNESKNQKKKNSEAIFKI
NFIKSQKDSGEQKDSKNQEQQTESKRFKFIENATIQEKIIFTLDDLINNIGNMIKSQINE
PKIIQRVKGLIQDILKLEELIQTNEQKKLKVELNLENIFDFSQLLASTNTSLKKCGAISY
GLPKIASYNRTFADECLRKKIELMNLLLLNCQRDMLLQTMFFGITKNLTNLKQDESENYQ
QEQKGSHQTNDGLFKTQSLNNNNNSSLAGETKKLQKILVSQQQNQNENQQDALASN


>TTHERM_00672290(gene)
ATGTCTGTTTTAACATTTAAGCATTACAGCTTTTTGAGTATCCTGCTAGCAGGAGGAGCT
ATAATAAATTCTTATACTATTCATGAGCAATTCTATCCTACAATTATTTATCTGACAAAT
CAGAAATCTAATAAATTAATCATGCTCAATTTTTTTTTTATGTTGGGCTTAGCTTTTTTT
AAGATGATAATGTCAGTATTCTTTGGAGAAATCAGAGAGATAGAAAAACTTGTAAATAAT
TATTCATTTATCAATTAAAAAAGCAATAAAACATTTTATTTAGATTCATATATATTGATT
TACTTTTGATAAATAAGAGTATTTTAGATAGTTTAAAGAGAAAGATATTTGATATTGTAT
TCATCATATTGATTTACAAGGAAGATAACTTCGATTCCTCATTTTACTCATGGCTTATTG
TTTTAGGATTTATATGGGTGATCCATTAAGCAGCAATTAAAAGATCAGAATATGTAAAGA
AAAATATTTAAATTATATTTAAGATACTAATAATCTTATTAATTAATTTTAAATATTTGA
AAAATAACATTGTTTTTTTGAAAATAGCTTATAGCTGAGAGCATAACAGATGTAAAGATG
CACATGAAGTTAACAGTAATTTATATAGCACTGATTTGTTTGGACTCTTGTGTTCTTAGA
TATATGATAAAAGCATTCACAAATACTTCTGTAGATTCTTATTTAATTTTGTTTTTCTTA
GAATATTTACTGATAAGCTTGAATATCATATTTCCTGCAATTAAATACTTTACAATAGCT
TTTGAGATGTTTACATACTCTCATTTCTAAAATAAAAATAACTTCTTCATGGTATTAGAA
TTCGTTTTAACAGTTTGCAAATTGTGTATCTAGCTTTATATGAGAATTAAATACATGCTT
TTATTCCCTTTTATAGTCGACTTGATTGAAAACCTTATCCAGCTTTACAATACAATAGTT
AAATTCTTCTCATCAGTTAAGTTATTAAGGCTCTTAAACAAGTAAAATTGAATTTAATTT
TAAACAAAACTAAAAAATGATGCTATTTAAAATTTGATTAAGCAATTGCTTCTCAGATTG
TTTAATCTTAAAAGTCTTTTGAATAATTTCAATCTTTTTTGTAAAAAACTTTATTTTGAA
TTGAAAAGAGAGTCCAATCTTGATGAAAAATTAGATAAATTTTATACTTTATTTGTATTT
TCAATGAAAGAAAATATTATTAATTAATTATTTGGAATTTAAAAGATTACCTGATGTTAA
CTTGGAGGAAATAGAAGAAATAGATAACACCTGCTTGATCTGCTTATCAGAAATTAAGCA
TGGAAAAAAGATTGGATGTGGTCACTTTTTCCACAAAAACTGTTTAAAAGAGTTAATTTA
AGGAAAGTCAAATCAACTTTGTCCTAAATGCAGAAGCCCCATCAATATTGAGCAAGCCAT
TAAAGATCATCAAAATGAATCAAAAAATTAAAAAAAGAAAAATTCTGAAGCTATTTTCAA
AATAAATTTTATTAAGAGCTAGAAAGATTCAGGAGAATAAAAAGACAGTAAAAATTAAGA
ATAATAAACTGAGTCTAAGAGATTTAAGTTTATAGAAAATGCAACCATCTAAGAAAAAAT
TATTTTCACTCTAGGTAATTAATGTTTATTTAAAAAAATGTCTTTTATTTTTACTACGTA
AATTTGGTAGATAAAACCCAATTTCTTACTCCTAGTAGTAAATTTTAATATAAAATTTTT
CTAATTTTAAAAAATCTAAAATAAATGAAATAAGTTTAAAATAGATTGAATAAATATTTT
TAGCAAATCAATAACTTAAATAAACAATAAAAATATTTTTTAGAGAATCTATTTAATATA
TAAAATAAAATAGAAAGATAATTCATCCTAAAAATATTCATTCAATAAATTTCAAGAATT
TTTTTATTTAAGTAAACAAATTTACTTGATTTGATAATTAAATTAATTTAGGATGATATT
AATAATTTTATAAAATACTACATATTGATGAATTTAAACATTTTATTTACAAGTCATATC
TTAAATTAATATCTATCTGCTTTTTATTTAAATAAAATAATATTCAAAGTTTATATTTAT
TTTTAATTTATTGATTGATTTATTTATTTATTTTTATAAAAAAGATGATCTTATTAATAA
CATTGGTAATATGATTAAATCTTAAATCAACGAACCTAAGATCATTTAGAGAGTTAAAGG
CTTAATTTAAGATATCTTAAAACTTGAAGAATTGATTTAAACAAATGAATAAAAGAAATT
AAAAGTAGAACTTAATCTGGAAAATATTTTTGATTTTAGTTAATTGCTTGCTAGCACAAA
CACTTCTTTGAAAAAATGTAATTTTTTATTTTTATTTTTCAGTATGCTAAAATTATTTTT
ATATTTAAAAGGTGGTGCTATTTCTTATGGACTGCCGAAAATAGCTAGCTACAACCGTAC
TTTTGCTGATGAGTGTCTGAGAAAAAAGATTGAATTGATGAATTTATTGCTTTTGAACTG
CTAAAGAGATATGTTACTATAAACAATGTTCTTTGGGATTACTAAGAATTTGACTAACCT
AAAACAAGACGAAAGTGAAAATTATTAATAAGAACAAAAAGGTTCTCATTAGACTAATGA
TGGTTTATTTAAGACTTAAAGTTTGAACAATAATAATAATTCTTCGCTTGCTGGTGAAAC
AAAAAAATTACAAAAGATATTAGTTAGTTAAGTAAAAATACATCAGTTATCGTTGATGAA
ACATCCATTTTTTAGAAAAATAATTCGAAGATAGATCCTCAAGAAGAAGAAAGAGAGAGG
AGATTAGCTTGGATAGAAAAATTGTAATCTCAAGTATCTTAATCAAACGAATAGTAATAA
AATTAGTAATAAGAATAATAATAGCAATAAAACTAAAATGAAAATTAATAAGATGCTCTA
GCCTCTAACTGA