Identifiers and Description

Gene Model Identifier

TTHERM_00518469

Standard Name

GST28 (Glutathione S-transferase mu 28, TtGSTm28, GSTm28)

Aliases

3723.m00730

Description

Glutathione S-transferase Mu, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19%

TetraMine Data

TTHERM_00518469

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15445.11.99970314379378e-94glutathione S-transferase Mu (
216 aa)
OxytrichaContig16299.0.g152.0002795641672355e-21Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02740810.00000019998969434520019DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017720.00000030014504373857585locus:gst-24 status:Confirme
d UniProt:Q93694 protein_i
d:CAB02295.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00518469(protein)
MIVLGYWNLRGYAQPIRLLLEYLQVEYKDKLYHENGEEWFNTDKQELKTNFPNLPYLIDG
DVVVTESIVIPIYLAKKFKKYELIGQNNDGSFNQNEIIFLEILSILKDLRDTLNSSARVP
SFKQEKDKIFNEKFNVTFEKIKKQLGENKFLLGNLSYIDFYFYEVLKIFKFFYPNLSIFT
DYIDRIENIPQIKNYLETKENKIFLLDRMKSLYYY


>TTHERM_00518469(coding)
ATGATTGTCCTTGGCTATTGGAATCTAAGAGGTTATGCTTAACCTATTCGTTTGCTTCTT
GAATATTTATAAGTTGAATATAAGGATAAGCTTTATCATGAAAATGGAGAAGAATGGTTC
AATACTGATAAGTAAGAACTCAAGACTAACTTCCCTAATTTACCTTATCTAATTGATGGG
GATGTTGTTGTGACAGAATCTATAGTAATTCCTATTTATTTAGCTAAAAAGTTCAAAAAG
TATGAACTTATTGGCTAAAATAATGATGGATCCTTTAACTAAAATGAAATTATTTTCCTT
GAAATTTTATCAATCCTGAAAGATCTCAGAGATACATTAAATAGTTCAGCTAGAGTGCCA
TCTTTTAAATAAGAAAAAGATAAAATTTTCAATGAAAAGTTCAACGTTACTTTTGAGAAA
ATTAAGAAATAACTTGGAGAAAACAAATTCCTTCTTGGAAATTTATCTTATATAGATTTC
TATTTTTACGAAGTTTTGAAAATTTTCAAATTCTTTTATCCTAATCTCTCAATCTTTACT
GACTATATTGATAGAATAGAAAATATTCCTCAAATAAAAAACTATCTTGAAACAAAAGAA
AATAAAATCTTTCTTCTTGATAGGATGAAAAGCTTGTATTACTACTGA


>TTHERM_00518469(gene)
ATGATTGTCCTTGGCTATTGGAATCTAAGAGGTTATGCTTAACCTATTCGTTTGCTTCTT
GAATATTTATAAGTTGAATATAAGGATAAGCTTTATCATGAAAATGGAGAAGAATGGTTC
AATACTGATAAGTAAGAACTCAAGACTAACTTCCCTAATTTACCTTATCTAATTGATGGG
GATGTTGTTGTGACAGAATCTATAGTAATTCCTATTTATTTAGCTAAAAAGTTCAAAAAG
TATGAACTTATTGGCTAAAATAATGATGGATCCTTTAACTAAAATGAAATTATTTTCCTT
GAAATTTTATCAATCCTGAAAGATCTCAGAGATACATTAAATAGTTCAGCTAGAGTGCCA
TCTTTTAAATAAGAAAAAGATAAAATTTTCAATGAAAAGTTCAACGTTACTTTTGAGGTA
TCGAAATATATTTTTGAAACTTTAAAAAAGATTAATTTATTTATTTTTTTTATTTAAAAA
TGTAGAAAATTAAGAAATAACTTGGAGAAAACAAATTCCTTCTTGGAAATTTATCTTATA
TAGATTTCTATTTTTACGAAGTTTTGAAAATTTTCAAATTCTTTTATCCTAATCTCTCAA
TCTTTACTGACTATATTGATAGAATAGAAAATATTCCTCAAATAAAAAACTATCTTGAAA
CAAAAGAAAATAAAATCTTTCTTCTTGATAGGATGAAAAGCTTGTATTACTACTGA