Identifiers and Description

Gene Model Identifier

TTHERM_00516440

Standard Name

GST27 (Glutathione S-transferase mu 27, TtGSTm27, GSTm27)

Aliases

PreTt10736 | 64.m00216 | 3723.m00072

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain
  • ( PF06445 ) Bacterial transcription activator, effector binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 21.5%

TetraMine Data

TTHERM_00516440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15445.11.0002434920975502e-91glutathione S-transferase Mu (
216 aa)
OxytrichaContig12816.0.g911.9994498063102785e-22Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017820.00000019998969434520019locus:gst-34 status:Partiall
y_confirmed UniProt:Q86S58
protein_id:CCD73729.1
DictyBaseDDB_G02740810.00000030014504373857585DDB_G0274081 on chromosome: 2
position 3748941 to 3749724

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00516440(coding)
ATGATAATCCTTGGTTACTGGAATCTAAGAGGCTACGCTTAACCTATTCGTCTCCTTCTA
GAATATTTGTAAGTAGATTATAAGGAAAAACTTTATAACTAAGATGGAGAAGAATGGTTA
AATGTTGATAAATAATAACTTAAAACTAATTTCCCTAACTTACCTTATATAATTGATGGA
GATATTGTTGTAACAGAATCAAAAGTTATTCCTATTTACTTGGCCAAGAAATTCAAAAAT
TATGAGCTTATTGGCTAAAATCCTGATGGGTCTTTTAATTTGAATGAAATTACATTCCTT
TAAATCTTAGAAATTTTGAAAGAACTCAGAGATTCGTTATTGAATTCAGCAAAAGTACCA
TCTTTCAAAGAAGAAAAAGATTAAATTTTCAATGAAAAATTCAACATTACTTTTGAGAAA
ATAAAGAAACAACTTGGAGAGAACAAATACCTGCTTGGAAATCTTTCATTTATAGATTTC
TATTTTTATGAAGTTTTGAAATTTTTCTAATTCTTTTATCCAAAACTTTCAATCTTTACC
GACTATATTGATAGAATAGAAAATATTCCTCAAATAAAAAACTATCTTGAAACAAAAGAA
AACAAAATCTTTATTCTTGATAGAATGAAAAGCTATTTTTATTATTGA


>TTHERM_00516440(protein)
MIILGYWNLRGYAQPIRLLLEYLQVDYKEKLYNQDGEEWLNVDKQQLKTNFPNLPYIIDG
DIVVTESKVIPIYLAKKFKNYELIGQNPDGSFNLNEITFLQILEILKELRDSLLNSAKVP
SFKEEKDQIFNEKFNITFEKIKKQLGENKYLLGNLSFIDFYFYEVLKFFQFFYPKLSIFT
DYIDRIENIPQIKNYLETKENKIFILDRMKSYFYY


>TTHERM_00516440(gene)
ATGATAATCCTTGGTTACTGGAATCTAAGAGGCTACGCTTAACCTATTCGTCTCCTTCTA
GAATATTTGTAAGTAGATTATAAGGAAAAACTTTATAACTAAGATGGAGAAGAATGGTTA
AATGTTGATAAATAATAACTTAAAACTAATTTCCCTAACTTACCTTATATAATTGATGGA
GATATTGTTGTAACAGAATCAAAAGTTATTCCTATTTACTTGGCCAAGAAATTCAAAAAT
TATGAGCTTATTGGCTAAAATCCTGATGGGTCTTTTAATTTGAATGAAATTACATTCCTT
TAAATCTTAGAAATTTTGAAAGAACTCAGAGATTCGTTATTGAATTCAGCAAAAGTACCA
TCTTTCAAAGAAGAAAAAGATTAAATTTTCAATGAAAAATTCAACATTACTTTTGAGGTA
TTTGAATACAATTTTTTTAATTTACTAAATATTTAATTATTATTATAAACATAGAAAATA
AAGAAACAACTTGGAGAGAACAAATACCTGCTTGGAAATCTTTCATTTATAGATTTCTAT
TTTTATGAAGTTTTGAAATTTTTCTAATTCTTTTATCCAAAACTTTCAATCTTTACCGAC
TATATTGATAGAATAGAAAATATTCCTCAAATAAAAAACTATCTTGAAACAAAAGAAAAC
AAAATCTTTATTCTTGATAGAATGAAAAGCTATTTTTATTATTGA