Identifiers and Description

Gene Model Identifier

TTHERM_00794370

Standard Name

GST26 (Glutathione S-transferase mu 26, TtGSTm26, GSTm26)

Aliases

PreTt21436 | 134.m00116

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.4%

TetraMine Data

TTHERM_00794370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13311.15.00077931415004e-148glutathione S-transferase doma
in-containing protein (250 aa)
OxytrichaContig16299.0.g150.0000000000000700196834671948Glutathione S-transferase, N-t
erminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00794370(coding)
ATGTCTAAATAATCTTAAGAAAATTAACAAACTGATTTAGTGCTAGGCTATTGGCCATTT
GCAGGAAGAAATATGCCAGTTATTTTTATGCTGGAAATACTAAATATCCCTTATTAAGTT
AATATTTTTGACCAAAACACATGGTTTGGTAAAGAAAAAGAAGACCTCAATTTAGATTTC
CCAAATCTACCATTCCTTATTGATAACTCTAATGGTATGAAGATTACTGAAATACATAAC
ATCGTTAACTATATTCTCTATAAATATGAGAAAGGAAGAAATTTGTAGGACATTCATCGC
TCAAGTCCTTACACCTAAAGTCGCAATAGAGTTAAGTTGTCAGCTGATCATTCATCATAT
AATCCTATCGACGACTTCAAGATTGATGAAATCAGATTTATTTTAAACGATGTCTTCACT
CAAATATCTTCTGCTACTGCTAAGTTCCCCTAAGAAAACTAGATAAAATACGCTTAAGAT
ACCATAGTACCAAAATTGAATAAATTAATTAAATTTATAGAACAAAAAAATTAAGCTACT
ACATCATATACTCAATACTTTGTTATGGGGTATTTAAGTGTTGTAGACTGTTACTTCTAC
ATAATATCTAAGTACTTCTAGAAGTATTTCCCCTCACTTTATGATGATTACTCACATGTA
TTCGACTTGGTCCTTAATAGCTTTGAAAATATTCCTGAAATAAAAAAATACATCAATTCT
GATAAATATCCAACTCTAGGGTGA


>TTHERM_00794370(protein)
MSKQSQENQQTDLVLGYWPFAGRNMPVIFMLEILNIPYQVNIFDQNTWFGKEKEDLNLDF
PNLPFLIDNSNGMKITEIHNIVNYILYKYEKGRNLQDIHRSSPYTQSRNRVKLSADHSSY
NPIDDFKIDEIRFILNDVFTQISSATAKFPQENQIKYAQDTIVPKLNKLIKFIEQKNQAT
TSYTQYFVMGYLSVVDCYFYIISKYFQKYFPSLYDDYSHVFDLVLNSFENIPEIKKYINS
DKYPTLG


>TTHERM_00794370(gene)
ATGTCTAAATAATCTTAAGAAAATTAACAAACTGATTTAGTGCTAGGCTATTGGCCATTT
GCAGGAAGAAATATGCCAGTTATTTTTATGCTGGAAATACTAAATATCCCTTATTAAGTT
AATATTTTTGACCAAAACACATGGTTTGGTAAAGAAAAAGAAGACCTCAATTTAGATTTC
CCAAATCTACCATTCCTTATTGATAACTCTAATGGTATGAAGATTACTGAAATACATAAC
ATCGTTAACTATATTCTCTATAAATATGAGAAAGGAAGAAATTTGTAGGACATTCATCGC
TCAAGTCCTTACACCTAAAGTCGCAATAGAGTTAAGTTGTCAGCTGATCATTCATCATAT
AATCCTATCGACGACTTCAAGATTGATGAAATCAGATTTATTTTAAACGATGTCTTCACT
CAAATATCTTCTGCTACTGCTAAGTTCCCCTAAGAAAACTAGATAAAATACGCTTAAGAT
ACCATAGTACCAAAATTGAATAAATTAATTAAATTTATAGAACAAAAAAATTAAGCTACT
ACATCATATACTCAATACTTTGTTATGGGGTATTTAAGTGTTGTAGACTGTTACTTCTAC
ATAATATCTAAGTACTTCTAGAAGTATTTCCCCTCACTTTATGATGATTACTCACATGTA
TTCGACTTGGTCCTTAATAGCTTTGAAAATATTCCTGAAATAAAAAAATACATCAATTCT
GATAAATATCCAACTCTAGGGTGA