Identifiers and Description

Gene Model Identifier

TTHERM_00332090

Standard Name

GST24 (Glutathione S-transferase mu 24, TtGSTm24, GSTm24)

Aliases

PreTt30316 | 33.m00328 | 3705.m00152

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00332090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08511.18.996145899952539e-121glutathione S-transferase doma
in-containing protein (207 aa)
OxytrichaContig16299.0.g154.0006511639687014e-23Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017620.0000007001298633766835locus:gst-14 status:Partiall
y_confirmed UniProt:Q93696
protein_id:CAB02289.1
DictyBaseDDB_G02835750.000019995566179747357DDB_G0283575 on chromosome: 4
position 855359 to 856264

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00332090(coding)
ATGACAGATAATAAATTGACTCTTGGTTATTGGGAAGGTTATGGCAAAGCACAACCTGCA
AGATATTTATTAGAGCTCACTAAGACTCCTTACAACAATGTGTAGTATGTTGAAGATGAC
AAATGGTTCAAATAAGATAAGCTAAATTTAGGTTTAGATTTCCCTAACCTTCCTTATGTG
ATTGATGGAGAGTTTAAGTTGACTGAATTTGTAGCTATTTTTGATTATTTGTCTGAAAAG
TATGGTAAACCAGAATGGCTAGGTAAGGGTAACGACAAATATGTAGTTTCTTCCCTTAGA
AGTCTTTTTGATGAATTGGCAAGTTTAAACTATCACGGAAGCTTGAAAAAAACTGAAGAA
GAAAAGAAATAACACATTTTAGATAACATTGTTCCTAAATATAGATATTTATCTAAATTT
ATTGGCAAAAAGGAATATTTGCTTGGATACTTTACAGTTGCAGATCTTTATTTCTTAAGC
GTTATTAATGCTTTTAAGGCAACCCTCCCTCAAGACTCTTATGCTGAATTTGCACCAGTT
TTTGATCCTATTATTCATAGAATAGCTTCAATTCCTGAAATAGCTGCTTATATTGCATCA
GATCGTCATCCTAAATAATGA


>TTHERM_00332090(protein)
MTDNKLTLGYWEGYGKAQPARYLLELTKTPYNNVQYVEDDKWFKQDKLNLGLDFPNLPYV
IDGEFKLTEFVAIFDYLSEKYGKPEWLGKGNDKYVVSSLRSLFDELASLNYHGSLKKTEE
EKKQHILDNIVPKYRYLSKFIGKKEYLLGYFTVADLYFLSVINAFKATLPQDSYAEFAPV
FDPIIHRIASIPEIAAYIASDRHPKQ


>TTHERM_00332090(gene)
ATGACAGATAATAAATTGACTCTTGGTTATTGGGAAGGTTATGGCAAAGCACAACCTGCA
AGATATTTATTAGAGCTCACTAAGACTCCTTACAACAATGTGTAGTATGTTGAAGATGAC
AAATGGTTCAAATAAGATAAGCTAAATTTAGGTTTAGATTTCCCTAACCTTCCTTATGTG
ATTGATGGAGAGTTTAAGTTGACTGAATTTGTAGCTATTTTTGATTATTTGTCTGAAAAG
TATGGTAAACCAGAATGGCTAGGTAAGGGTAACGACAAATATGTAGTTTCTTCCCTTAGA
AGTCTTTTTGATGAATTGGCAAGTTTAAACTATCACGGAAGCTTGAAAAAAACTGAAGAA
GAAAAGAAATAACACATTTTAGATAACATTGTTCCTAAATATAGATATTTATCTAAATTT
ATTGGCAAAAAGGAATATTTGCTTGGATACTTTACAGTTGCAGATCTTTATTTCTTAAGC
GTTATTAATGCTTTTAAGGCAACCCTCCCTCAAGACTCTTATGCTGAATTTGCACCAGTT
TTTGATCCTATTATTCATAGAATAGCTTCAATTCCTGAAATAGCTGCTTATATTGCATCA
GATCGTCATCCTAAATAATGA