Identifiers and Description

Gene Model Identifier

TTHERM_01289030

Standard Name

GST23 (Glutathione S-transferase mu 23, TtGSTm23, GSTm23)

Aliases

PreTt20212 | 310.m00027

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01289030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03489.14.0006908853687255e-76glutathione S-transferase doma
in-containing protein (203 aa)
OxytrichaContig16299.0.g150.00000000000059990805086298Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02740810.00010003404299092957DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017640.0002999184360822198locus:gst-16 status:Partiall
y_confirmed UniProt:Q93698
protein_id:CAB02291.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01289030(coding)
ATGTCTAAAATTATTATTGGTTAGTGGGCTTCAGCTGGAAAGCTTGTACCAATTAAATTG
TTACTAGAATTAGCAGGTGCTTAATATGAAGTAGTAAATTACTCAAAACCTGATGAGTGG
TATGCAAAAGACAAGTTAATTCTTGGTTTACCATTCCCTAATTTACCTTATCTGATTGAA
GGAGACATTAAATTGACAGAGACTGAGACTATTTTTGACTATTTGGTATATAAACTCAAA
AAAAATGATCTTTTAGGTTAAGAAAAAGATAAATTCATTGTTGGAAATATTAGAAATTTA
TTTTCTGATTTATACGCAAAATTCAGCTAGTTTATTCAAAAACAAGGAGATGAAAAGCAG
CAAATACTAAATGAGCAAATCATTCCCAAAATCAAAGACATCCATAAATATTTGAACAAA
AAAGATTATTTGCTAGGTTACTTTACTGTTGCTGATTTATATTTGTTTCCTGCAGCTCTA
CTTTTGAAACAAAACCTTCCTCAAGTATACTCTGAGTTTGCAAGTTCATTTGACCCATTT
TTAATAAGAATATAACAAATTCCTTAAATAGCAGCCTATCTTTCTGATAATAGTAAAGTT
TGA


>TTHERM_01289030(protein)
MSKIIIGQWASAGKLVPIKLLLELAGAQYEVVNYSKPDEWYAKDKLILGLPFPNLPYLIE
GDIKLTETETIFDYLVYKLKKNDLLGQEKDKFIVGNIRNLFSDLYAKFSQFIQKQGDEKQ
QILNEQIIPKIKDIHKYLNKKDYLLGYFTVADLYLFPAALLLKQNLPQVYSEFASSFDPF
LIRIQQIPQIAAYLSDNSKV


>TTHERM_01289030(gene)
ATGTCTAAAATTATTATTGGTTAGTGGGCTTCAGCTGGAAAGCTTGTACCAATTAAATTG
TTACTAGAATTAGCAGGTGCTTAATATGAAGTAGTAAATTACTCAAAACCTGATGAGTGG
TATGCAAAAGACAAGTTAATTCTTGGTTTACCATTCCCTAATTTACCTTATCTGATTGAA
GGAGACATTAAATTGACAGAGACTGAGACTATTTTTGACTATTTGGTATATAAACTCAAA
AAAAATGATCTTTTAGGTTAAGAAAAAGATAAATTCATTGTTGGAAATATTAGAAATTTA
TTTTCTGATTTATACGCAAAATTCAGCTAGTTTATTCAAAAACAAGGAGATGAAAAGCAG
CAAATACTAAATGAGCAAATCATTCCCAAAATCAAAGACATCCATAAATATTTGAACAAA
AAAGATTATTTGCTAGGTTACTTTACTGTTGCTGATTTATATTTGTTTCCTGCAGCTCTA
CTTTTGAAACAAAACCTTCCTCAAGTATACTCTGAGTTTGCAAGTTCATTTGACCCATTT
TTAATAAGAATATAACAAATTCCTTAAATAGCAGCCTATCTTTCTGATAATAGTAAAGTT
TGA