Identifiers and Description

Gene Model Identifier

TTHERM_00274620

Standard Name

GST22 (Glutathione S-transferase mu 22, TtGSTm22, GSTm22)

Aliases

PreTt09902 | 24.m00333 | 3690.m00143

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00274620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03489.14.001456298413176e-90glutathione S-transferase doma
in-containing protein (203 aa)
OxytrichaContig12816.0.g917.002638123733849e-21Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_298040.000000005602796437537268
DictyBaseDDB_G02740810.000000007998594485613997DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017870.000009999254677478949locus:gst-39 status:Confirme
d UniProt:Q9NAB0 protein_i
d:CAB61107.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00274620(coding)
ATGTCTTAAAAAATCACTATTGGATATTGGAAAGGCCCTGGTAAGGTTTAACCTTCTAGA
TATTTACTTGAGATTTCTGGTGTTGAATATTAAGAAACCTTATACACTGATCCTGCTTAG
TGGTTTGGAAAAGATAAATACTCTCTAGACTTGCCTTTCCCAAATTTACCCTATCTGATT
GATGGAGATGTGAAACTAACAGAAAGTGAAACTATATTCGATTATTTAGTGAATAAACTG
AATATGAGCGAACTTTTAGGCAAAGAGTCAGATAGATTCATAGTTGATAATCTAAGGAAT
ATCTTCTCTGATCTTTGTACCAGCCTCTTTCAAGTATTTTAAAAATAAGGAGAAGAAAAA
TTAAAGATATTTAATTGCTAAATCCTACCTAAAGCTAACGACATTCACAAATTCCTCAAG
AATAAAGAATATTTGCTAGGATACTTTACAGTTGCAGATCTTTACTTTTTAAGTTTTGCT
AGAAATTTCAAAAGCTTTATGCCAGAACAATATGAAGAATTTGCAGGAACCTTTGATGCT
CTTAAAGAAAAGATTGAGTCAATCCCATAAATTGCATCTTATATTTCTGAAGGACGTCAT
CCAATTTTATGA


>TTHERM_00274620(protein)
MSQKITIGYWKGPGKVQPSRYLLEISGVEYQETLYTDPAQWFGKDKYSLDLPFPNLPYLI
DGDVKLTESETIFDYLVNKLNMSELLGKESDRFIVDNLRNIFSDLCTSLFQVFQKQGEEK
LKIFNCQILPKANDIHKFLKNKEYLLGYFTVADLYFLSFARNFKSFMPEQYEEFAGTFDA
LKEKIESIPQIASYISEGRHPIL


>TTHERM_00274620(gene)
ATGTCTTAAAAAATCACTATTGGATATTGGAAAGGCCCTGGTAAGGTTTAACCTTCTAGA
TATTTACTTGAGATTTCTGGTGTTGAATATTAAGAAACCTTATACACTGATCCTGCTTAG
TGGTTTGGAAAAGATAAATACTCTCTAGACTTGCCTTTCCCAAATTTACCCTATCTGATT
GATGGAGATGTGAAACTAACAGAAAGTGAAACTATATTCGATTATTTAGTGAATAAACTG
AATATGAGCGAACTTTTAGGCAAAGAGTCAGATAGATTCATAGTTGATAATCTAAGGAAT
ATCTTCTCTGATCTTTGTACCAGCCTCTTTCAAGTATTTTAAAAATAAGGAGAAGAAAAA
TTAAAGATATTTAATTGCTAAATCCTACCTAAAGCTAACGACATTCACAAATTCCTCAAG
AATAAAGAATATTTGCTAGGATACTTTACAGTTGCAGATCTTTACTTTTTAAGTTTTGCT
AGAAATTTCAAAAGCTTTATGCCAGAACAATATGAAGAATTTGCAGGAACCTTTGATGCT
CTTAAAGAAAAGATTGAGTCAATCCCATAAATTGCATCTTATATTTCTGAAGGACGTCAT
CCAATTTTATGA