Identifiers and Description

Gene Model Identifier

TTHERM_00569210

Standard Name

GST21 (Glutathione S-transferase mu 21, TtGSTm21, GSTm21)

Aliases

PreTt10451 | 76.m00153 | 3810.m02014

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.7%

TetraMine Data

TTHERM_00569210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03489.16.996673098078189e-105glutathione S-transferase doma
in-containing protein (203 aa)
OxytrichaContig16299.0.g152.000769134519826e-18Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017760.000000019990673443141236locus:gst-28 status:Confirme
d UniProt:Q9NAB2 protein_i
d:CAB61105.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00569210(coding)
ATGTCAGATAAAATTATCCTTGGTTATTGGAATACACCTGGCAAAGCTCAACCTTCAAGA
TACTTACTTGAACTATCGGGAGTTAAATATGAAGAAGTGAGATACTCTTATCCTGCTGCA
GAATGGTTTGGTAGAGACAAATATGCTTTGGGATTACCTTTTCCTAATTTGCCTTATCTC
TTAGATGGGGAAGTAAAAATCACTGAGAGTGAAACCATTTTTGACTATTTAATTTAAAGA
TTAAATAAAGTTGAGCTTTTAGGTTAGGGAAACGATAAATACATTGTTGATAATCTTAAA
AACCTGTTTTCTGATATTGGAACAAGAATGTACATTTATAGCTAGAAGGAGGGAGAAGAA
TAAACTAAATTCTTAAGTGAGTAAATCCTTCCTAAAATAAGAGACATTCATAAATTTTTA
GGATAAAAAGAGTACTTACTAGGATATTTTACAGCTGCTGATTTGTATTTTTTATGCTTT
GCAAAAGGTTTTAAAAATACTCTTCCTGATTCTTACAATGAATTTGCTGCAACTTTTAAT
CCATTGATATAAAGACTTGAGAATATCCCCTAAATTGCCAAGTATATTTCTGAAGGTCGT
CATCCATGA


>TTHERM_00569210(protein)
MSDKIILGYWNTPGKAQPSRYLLELSGVKYEEVRYSYPAAEWFGRDKYALGLPFPNLPYL
LDGEVKITESETIFDYLIQRLNKVELLGQGNDKYIVDNLKNLFSDIGTRMYIYSQKEGEE
QTKFLSEQILPKIRDIHKFLGQKEYLLGYFTAADLYFLCFAKGFKNTLPDSYNEFAATFN
PLIQRLENIPQIAKYISEGRHP


>TTHERM_00569210(gene)
ATGTCAGATAAAATTATCCTTGGTTATTGGAATACACCTGGCAAAGCTCAACCTTCAAGA
TACTTACTTGAACTATCGGGAGTTAAATATGAAGAAGTGAGATACTCTTATCCTGCTGCA
GAATGGTTTGGTAGAGACAAATATGCTTTGGGATTACCTTTTCCTAATTTGCCTTATCTC
TTAGATGGGGAAGTAAAAATCACTGAGAGTGAAACCATTTTTGACTATTTAATTTAAAGA
TTAAATAAAGTTGAGCTTTTAGGTTAGGGAAACGATAAATACATTGTTGATAATCTTAAA
AACCTGTTTTCTGATATTGGAACAAGAATGTACATTTATAGCTAGAAGGAGGGAGAAGAA
TAAACTAAATTCTTAAGTGAGTAAATCCTTCCTAAAATAAGAGACATTCATAAATTTTTA
GGATAAAAAGAGTACTTACTAGGATATTTTACAGCTGCTGATTTGTATTTTTTATGCTTT
GCAAAAGGTTTTAAAAATACTCTTCCTGATTCTTACAATGAATTTGCTGCAACTTTTAAT
CCATTGATATAAAGACTTGAGAATATCCCCTAAATTGCCAAGTATATTTCTGAAGGTCGT
CATCCATGA