Identifiers and Description

Gene Model Identifier

TTHERM_00569210

Standard Name

GST21 (Glutathione S-transferase mu 21, TtGSTm21, GSTm21)

Aliases

PreTt10451 | 76.m00153 | 3810.m02014

Description

GST21 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.7%

TetraMine Data

TTHERM_00569210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03489.16.996673098078189e-105glutathione S-transferase doma
in-containing protein (203 aa)
OxytrichaContig16299.0.g152.000769134519826e-18Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017760.000000019990673443141236locus:gst-28 status:Confirme
d UniProt:Q9NAB2 protein_i
d:CAB61105.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00569210(coding)
ATGTCAGATAAAATTATCCTTGGTTATTGGAATACACCTGGCAAAGCTCAACCTTCAAGA
TACTTACTTGAACTATCGGGAGTTAAATATGAAGAAGTGAGATACTCTTATCCTGCTGCA
GAATGGTTTGGTAGAGACAAATATGCTTTGGGATTACCTTTTCCTAATTTGCCTTATCTC
TTAGATGGGGAAGTAAAAATCACTGAGAGTGAAACCATTTTTGACTATTTAATTTAAAGA
TTAAATAAAGTTGAGCTTTTAGGTTAGGGAAACGATAAATACATTGTTGATAATCTTAAA
AACCTGTTTTCTGATATTGGAACAAGAATGTACATTTATAGCTAGAAGGAGGGAGAAGAA
TAAACTAAATTCTTAAGTGAGTAAATCCTTCCTAAAATAAGAGACATTCATAAATTTTTA
GGATAAAAAGAGTACTTACTAGGATATTTTACAGCTGCTGATTTGTATTTTTTATGCTTT
GCAAAAGGTTTTAAAAATACTCTTCCTGATTCTTACAATGAATTTGCTGCAACTTTTAAT
CCATTGATATAAAGACTTGAGAATATCCCCTAAATTGCCAAGTATATTTCTGAAGGTCGT
CATCCATGA


>TTHERM_00569210(protein)
MSDKIILGYWNTPGKAQPSRYLLELSGVKYEEVRYSYPAAEWFGRDKYALGLPFPNLPYL
LDGEVKITESETIFDYLIQRLNKVELLGQGNDKYIVDNLKNLFSDIGTRMYIYSQKEGEE
QTKFLSEQILPKIRDIHKFLGQKEYLLGYFTAADLYFLCFAKGFKNTLPDSYNEFAATFN
PLIQRLENIPQIAKYISEGRHP


>TTHERM_00569210(gene)
ATGTCAGATAAAATTATCCTTGGTTATTGGAATACACCTGGCAAAGCTCAACCTTCAAGA
TACTTACTTGAACTATCGGGAGTTAAATATGAAGAAGTGAGATACTCTTATCCTGCTGCA
GAATGGTTTGGTAGAGACAAATATGCTTTGGGATTACCTTTTCCTAATTTGCCTTATCTC
TTAGATGGGGAAGTAAAAATCACTGAGAGTGAAACCATTTTTGACTATTTAATTTAAAGA
TTAAATAAAGTTGAGCTTTTAGGTTAGGGAAACGATAAATACATTGTTGATAATCTTAAA
AACCTGTTTTCTGATATTGGAACAAGAATGTACATTTATAGCTAGAAGGAGGGAGAAGAA
TAAACTAAATTCTTAAGTGAGTAAATCCTTCCTAAAATAAGAGACATTCATAAATTTTTA
GGATAAAAAGAGTACTTACTAGGATATTTTACAGCTGCTGATTTGTATTTTTTATGCTTT
GCAAAAGGTTTTAAAAATACTCTTCCTGATTCTTACAATGAATTTGCTGCAACTTTTAAT
CCATTGATATAAAGACTTGAGAATATCCCCTAAATTGCCAAGTATATTTCTGAAGGTCGT
CATCCATGA