Identifiers and Description

Gene Model Identifier

TTHERM_00569160

Standard Name

GST20 (Glutathione S-transferase mu 20, TtGSTm20, GSTm20)

Aliases

PreTt10446 | 76.m00148 | 3810.m02009

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00569160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03489.14.999133404870476e-103glutathione S-transferase doma
in-containing protein (203 aa)
OxytrichaContig16299.0.g151.000116773704384e-19Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017850.000005000363240844623locus:gst-37 status:Partiall
y_confirmed UniProt:Q9BPM4
protein_id:CCD74297.1
DictyBaseDDB_G02740810.000030009396760408108DDB_G0274081 on chromosome: 2
position 3748941 to 3749724

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00569160(coding)
ATGGCTTATAAAATTGTTCTTGGTTATTGGGCTGGTCCTGGTAAGGCTCAACCTGCTAGA
TATTTACTTGAAATCTCAGGAGTTAAATACTAAGATGTCAGATATTCTAAACCTGCTGAT
TGGTTTGGAAAAGATAAGTATGCCTTAGGATTACCTTTCCCCAACTTACCTTACCTTATA
GATGGAGATGTAAAAATCACTGAAAGTGAAACTATCTTTGATTACTTGATTCATAAACTC
AACAAAACATAACTTTTAGGCTAGGATAATGATAAGTACACTGTAGATACTCTCAGAAAT
CTTATTGGTGATATTGGTACTAGATTGTAAATGCTTACTTAAAAGGAAGGAGATGACAAA
ACTAAATTCTTAAATGAATAAGTTCTTCCTAAGATTAAAGATATCCACAAATTCTTAGGA
CATAAGGAATATCTTTTAGGATATTTCACTGCTGCTGACCTTTACTTCTTAAGTTTCGCT
AGAAATCTAAAGAAATTTTACCCTGAGACTTACTAAGAATTTGCTCTAACCTTTGATGGT
TTGGTAACTAGACTTGAAGCCATTCCTTAAATCGCTGCTTACATTTCAGAAAAGCGTCAT
CCTTGA


>TTHERM_00569160(protein)
MAYKIVLGYWAGPGKAQPARYLLEISGVKYQDVRYSKPADWFGKDKYALGLPFPNLPYLI
DGDVKITESETIFDYLIHKLNKTQLLGQDNDKYTVDTLRNLIGDIGTRLQMLTQKEGDDK
TKFLNEQVLPKIKDIHKFLGHKEYLLGYFTAADLYFLSFARNLKKFYPETYQEFALTFDG
LVTRLEAIPQIAAYISEKRHP


>TTHERM_00569160(gene)
ATGGCTTATAAAATTGTTCTTGGTTATTGGGCTGGTCCTGGTAAGGCTCAACCTGCTAGA
TATTTACTTGAAATCTCAGGAGTTAAATACTAAGATGTCAGATATTCTAAACCTGCTGAT
TGGTTTGGAAAAGATAAGTATGCCTTAGGATTACCTTTCCCCAACTTACCTTACCTTATA
GATGGAGATGTAAAAATCACTGAAAGTGAAACTATCTTTGATTACTTGATTCATAAACTC
AACAAAACATAACTTTTAGGCTAGGATAATGATAAGTACACTGTAGATACTCTCAGAAAT
CTTATTGGTGATATTGGTACTAGATTGTAAATGCTTACTTAAAAGGAAGGAGATGACAAA
ACTAAATTCTTAAATGAATAAGTTCTTCCTAAGATTAAAGATATCCACAAATTCTTAGGA
CATAAGGAATATCTTTTAGGATATTTCACTGCTGCTGACCTTTACTTCTTAAGTTTCGCT
AGAAATCTAAAGAAATTTTACCCTGAGACTTACTAAGAATTTGCTCTAACCTTTGATGGT
TTGGTAACTAGACTTGAAGCCATTCCTTAAATCGCTGCTTACATTTCAGAAAAGCGTCAT
CCTTGA