Identifiers and Description

Gene Model Identifier

TTHERM_00211500

Standard Name

GST2 (Glutathione S-transferase mu 2, TtGSTm2,GSTm2)

Aliases

PreTt13830 | 17.m00437

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07460 ) NUMOD3 motif
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00211500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04320.17.998842802738429e-74glutathione S-transferase doma
in-containing protein (220 aa)
OxytrichaContig16299.0.g150.0000000000000700196834671948Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017770.0005997485943342685locus:gst-29 status:Confirme
d UniProt:Q9NAB1 protein_i
d:CAB61106.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00211500(coding)
ATGGACTCTTCGAATACAACTAACTAAATTGGAAAAAAACAAACCAATGAATCTAAAGAG
TTAATCATAGGCTATTTGGAGAATGCCTCAAGAGGTTAAACTGTTAGATATATCTTAGAT
CTTGTAGGTTATCCTTACGCTGAACATAAGTACACTTCTTCATCTACTGAATGGGAAAAA
AAAAAATCAGAGCTTGGATTAGATTTCCCAAATCTTCCTTACCTGATTCATGGAGACTTT
TCAATATCCGAGTCTTAAAATATTGTGAATTATTTGATTGAATTAACAAATTAATAGTAC
CTGTATGGGGAAGGAAAAGAAAAATACAGAGTAGATAATATTAGATTTGTATGTGATGAT
TTATTTTCAAAAATTTATCAAGCATCAAAATAAAATGAAGATGGAAAGAACATGCTAAAT
TCTTAAGTTATTCCTAAAATTTAATAATTGCAAAAAGCATTAGGAAACAAGCCTTAGTTC
TTTGAAAGTTTAACTATCGCAGATCTTTATGCATACATAACTTTAAAAAATTTTAAAACA
GGCTGTTCGAATGCATACATAGAATTCGCTTCTACTTTTGATCCTTTTTTAAAAAGATTG
GAAGAAATCCTTTCTAAAAAAAACTAATATAAAAATAAATGA


>TTHERM_00211500(protein)
MDSSNTTNQIGKKQTNESKELIIGYLENASRGQTVRYILDLVGYPYAEHKYTSSSTEWEK
KKSELGLDFPNLPYLIHGDFSISESQNIVNYLIELTNQQYLYGEGKEKYRVDNIRFVCDD
LFSKIYQASKQNEDGKNMLNSQVIPKIQQLQKALGNKPQFFESLTIADLYAYITLKNFKT
GCSNAYIEFASTFDPFLKRLEEILSKKNQYKNK


>TTHERM_00211500(gene)
ATGGACTCTTCGAATACAACTAACTAAATTGGAAAAAAACAAACCAATGAATCTAAAGAG
TTAATCATAGGCTATTTGGAGAATGCCTCAAGAGGTTAAACTGTTAGATATATCTTAGAT
CTTGTAGGTTATCCTTACGCTGAACATAAGTACACTTCTTCATCTACTGAATGGGAAAAA
AAAAAATCAGAGCTTGGATTAGATTTCCCAAATCTTCCTTACCTGATTCATGGAGACTTT
TCAATATCCGAGTCTTAAAATATTGTGAATTATTTGATTGAATTAACAAATTAATAGTAC
CTGTATGGGGAAGGAAAAGAAAAATACAGAGTAGATAATATTAGATTTGTATGTGATGAT
TTATTTTCAAAAATTTATCAAGCATCAAAATAAAATGAAGATGGAAAGAACATGCTAAAT
TCTTAAGTTATTCCTAAAATTTAATAATTGCAAAAAGCATTAGGAAACAAGCCTTAGTTC
TTTGAAAGTTTAACTATCGCAGATCTTTATGCATACATAACTTTAAAAAATTTTAAAACA
GGCTGTTCGAATGCATACATAGAATTCGCTTCTACTTTTGATCCTTTTTTAAAAAGATTG
GAAGAAATCCTTTCTAAAAAAAACTAATATAAAAATAAATGA