Identifiers and Description

Gene Model Identifier

TTHERM_00569200

Standard Name

GST19 (Glutathione S-transferase mu 19, TtGSTm19, GSTm19)

Aliases

PreTt10450 | 76.m00152 | 3810.m02013

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00569200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03489.15.999646802955158e-114glutathione S-transferase doma
in-containing protein (203 aa)
OxytrichaContig12816.0.g916.002144168983342e-19Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02740810.000030009396760408108DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017850.00020003864201578029locus:gst-37 status:Partiall
y_confirmed UniProt:Q9BPM4
protein_id:CCD74297.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00569200(coding)
ATGGCTGATAAAATTGTTCTTGGTTATTGGGCTGGTCCTGGTAAGGCTCAACCTTCCAGA
TATTTACTTGAAATCTCAGGAGTTAAATACGAAGAAGTCAGATACACTAATCCTGCTGAT
TGGTTTGGAAAAGACAAGTATGCCTTAGGATTATCTTTCCCTAACTTACCTTACCTTTTA
GATGGAGATGTAAAAATCACTGAAAGTGAAACTATCTTTGATTACTTGATCCACAGACTC
AACAAAACAGAACTTTTAGGCAAGGATAATGATAAGTACACTGTAGATACTCTCAGAAAC
CTCTTTTCTGATATTGGCACCAGATTGTACATGCTTACTTAAAAGGAAGGTGATGACAAA
ACTAAATTCTTAAACGAATAAGTTCTTCCTAAGATTAAAGATATCCACAAATTCTTAGGA
CATAAGGAATATCTTTTAGGATATTTCACTGCTGCTGACCTTTACTTCTTAAGTTTCGCT
AGAGGTTTTAAGGCTAATCTCCCTGAAGCTTACAAAGAATTTGCTGCAACCTTCGATCCT
TTGGTAACTAGACTTGAAGCCATTCCTTAAATTGCTGCTTATATTTCAGAAAAGCGTCAT
CCTTGA


>TTHERM_00569200(protein)
MADKIVLGYWAGPGKAQPSRYLLEISGVKYEEVRYTNPADWFGKDKYALGLSFPNLPYLL
DGDVKITESETIFDYLIHRLNKTELLGKDNDKYTVDTLRNLFSDIGTRLYMLTQKEGDDK
TKFLNEQVLPKIKDIHKFLGHKEYLLGYFTAADLYFLSFARGFKANLPEAYKEFAATFDP
LVTRLEAIPQIAAYISEKRHP


>TTHERM_00569200(gene)
ATGGCTGATAAAATTGTTCTTGGTTATTGGGCTGGTCCTGGTAAGGCTCAACCTTCCAGA
TATTTACTTGAAATCTCAGGAGTTAAATACGAAGAAGTCAGATACACTAATCCTGCTGAT
TGGTTTGGAAAAGACAAGTATGCCTTAGGATTATCTTTCCCTAACTTACCTTACCTTTTA
GATGGAGATGTAAAAATCACTGAAAGTGAAACTATCTTTGATTACTTGATCCACAGACTC
AACAAAACAGAACTTTTAGGCAAGGATAATGATAAGTACACTGTAGATACTCTCAGAAAC
CTCTTTTCTGATATTGGCACCAGATTGTACATGCTTACTTAAAAGGAAGGTGATGACAAA
ACTAAATTCTTAAACGAATAAGTTCTTCCTAAGATTAAAGATATCCACAAATTCTTAGGA
CATAAGGAATATCTTTTAGGATATTTCACTGCTGCTGACCTTTACTTCTTAAGTTTCGCT
AGAGGTTTTAAGGCTAATCTCCCTGAAGCTTACAAAGAATTTGCTGCAACCTTCGATCCT
TTGGTAACTAGACTTGAAGCCATTCCTTAAATTGCTGCTTATATTTCAGAAAAGCGTCAT
CCTTGA