Identifiers and Description

Gene Model Identifier

TTHERM_00569200

Standard Name

GST19 (Glutathione S-transferase mu 19, TtGSTm19, GSTm19)

Aliases

PreTt10450 | 76.m00152 | 3810.m02013

Description

GST19 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.7%

TetraMine Data

TTHERM_00569200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03489.15.999646802955158e-114glutathione S-transferase doma
in-containing protein (203 aa)
OxytrichaContig12816.0.g916.002144168983342e-19Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02740810.000030009396760408108DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017850.00020003864201578029locus:gst-37 status:Partiall
y_confirmed UniProt:Q9BPM4
protein_id:CCD74297.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00569200(coding)
ATGGCTGATAAAATTGTTCTTGGTTATTGGGCTGGTCCTGGTAAGGCTCAACCTTCCAGA
TATTTACTTGAAATCTCAGGAGTTAAATACGAAGAAGTCAGATACACTAATCCTGCTGAT
TGGTTTGGAAAAGACAAGTATGCCTTAGGATTATCTTTCCCTAACTTACCTTACCTTTTA
GATGGAGATGTAAAAATCACTGAAAGTGAAACTATCTTTGATTACTTGATCCACAGACTC
AACAAAACAGAACTTTTAGGCAAGGATAATGATAAGTACACTGTAGATACTCTCAGAAAC
CTCTTTTCTGATATTGGCACCAGATTGTACATGCTTACTTAAAAGGAAGGTGATGACAAA
ACTAAATTCTTAAACGAATAAGTTCTTCCTAAGATTAAAGATATCCACAAATTCTTAGGA
CATAAGGAATATCTTTTAGGATATTTCACTGCTGCTGACCTTTACTTCTTAAGTTTCGCT
AGAGGTTTTAAGGCTAATCTCCCTGAAGCTTACAAAGAATTTGCTGCAACCTTCGATCCT
TTGGTAACTAGACTTGAAGCCATTCCTTAAATTGCTGCTTATATTTCAGAAAAGCGTCAT
CCTTGA


>TTHERM_00569200(protein)
MADKIVLGYWAGPGKAQPSRYLLEISGVKYEEVRYTNPADWFGKDKYALGLSFPNLPYLL
DGDVKITESETIFDYLIHRLNKTELLGKDNDKYTVDTLRNLFSDIGTRLYMLTQKEGDDK
TKFLNEQVLPKIKDIHKFLGHKEYLLGYFTAADLYFLSFARGFKANLPEAYKEFAATFDP
LVTRLEAIPQIAAYISEKRHP


>TTHERM_00569200(gene)
ATGGCTGATAAAATTGTTCTTGGTTATTGGGCTGGTCCTGGTAAGGCTCAACCTTCCAGA
TATTTACTTGAAATCTCAGGAGTTAAATACGAAGAAGTCAGATACACTAATCCTGCTGAT
TGGTTTGGAAAAGACAAGTATGCCTTAGGATTATCTTTCCCTAACTTACCTTACCTTTTA
GATGGAGATGTAAAAATCACTGAAAGTGAAACTATCTTTGATTACTTGATCCACAGACTC
AACAAAACAGAACTTTTAGGCAAGGATAATGATAAGTACACTGTAGATACTCTCAGAAAC
CTCTTTTCTGATATTGGCACCAGATTGTACATGCTTACTTAAAAGGAAGGTGATGACAAA
ACTAAATTCTTAAACGAATAAGTTCTTCCTAAGATTAAAGATATCCACAAATTCTTAGGA
CATAAGGAATATCTTTTAGGATATTTCACTGCTGCTGACCTTTACTTCTTAAGTTTCGCT
AGAGGTTTTAAGGCTAATCTCCCTGAAGCTTACAAAGAATTTGCTGCAACCTTCGATCCT
TTGGTAACTAGACTTGAAGCCATTCCTTAAATTGCTGCTTATATTTCAGAAAAGCGTCAT
CCTTGA