Identifiers and Description

Gene Model Identifier

TTHERM_00602870

Standard Name

GST18 (Glutathione S-transferase mu 18, TtGSTm18, GSTm18)

Aliases

PreTt27339 | 84.m00100

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00162 ) conserved hypothetical protein TIGR00162
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00602870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15521.12.000383902553626e-98glutathione S-transferase doma
in-containing protein (206 aa)
OxytrichaContig3021.0.g275.000468829272308e-18Glutathione S-transferase, C-t
erminal domain
DictyBaseDDB_G02740810.0007003012208360162DDB_G0274081 on chromosome: 2
position 3748941 to 3749724
WormBaseWBGene000017720.0009001042212099794locus:gst-24 status:Confirme
d UniProt:Q93694 protein_i
d:CAB02295.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00602870(coding)
ATGAGTGAATTAATTTTGGGATACTGGGGCCTTCCTTTAAAAGGACAACCTATCAGATAC
TTACTTGAATTAGGCAAGTAGGCTTATTAGGACAAAAAATATTCAAACAAAGATGAGTGG
TTTTAGCAAGATAAGTTAAATCTTGGACTCGACTTCCCTAATTTACCTTACATCATTCAT
GGAGATGTCAAGATGACAGAATCTTAAAATATAGTCGCTTACATCATTGATCTCACTAAG
TAAACAAATCTTTTGGGAGCAGATAAAACCAAATTCAAAATTCAAAATATAGTCCTTTTC
TGCAACGATTTGATTGGCTCATTCAAGCCCATCAGTATGAAACAAGGCGAAGAAAGAACT
TAAGAAATCGAAAAGATATTGCCTAAGATTAAATTATTAGAAAAAGATCTCAATAAAAAG
GCCCATTTCTTCAACAACTCTTTAACTTTGGCTGATATCTATGCTTACTGCATTATTGAT
AATTTCTAACAATTAGGTGGTGACTCCTACAAGCCATTTGAGGAATCATTCAAAGCTTTC
TTAGATGCCTTTAGAAGTATTCCCGAAATCAAAGCTTACATCGAGTCTGATCGTTGTACT
AGATTCTAATAATAATGA


>TTHERM_00602870(protein)
MSELILGYWGLPLKGQPIRYLLELGKQAYQDKKYSNKDEWFQQDKLNLGLDFPNLPYIIH
GDVKMTESQNIVAYIIDLTKQTNLLGADKTKFKIQNIVLFCNDLIGSFKPISMKQGEERT
QEIEKILPKIKLLEKDLNKKAHFFNNSLTLADIYAYCIIDNFQQLGGDSYKPFEESFKAF
LDAFRSIPEIKAYIESDRCTRFQQQ


>TTHERM_00602870(gene)
ATGAGTGAATTAATTTTGGGATACTGGGGCCTTCCTTTAAAAGGACAACCTATCAGATAC
TTACTTGAATTAGGCAAGTAGGCTTATTAGGACAAAAAATATTCAAACAAAGATGAGTGG
TTTTAGCAAGATAAGTTAAATCTTGGACTCGACTTCCCTAATTTACCTTACATCATTCAT
GGAGATGTCAAGATGACAGAATCTTAAAATATAGTCGCTTACATCATTGATCTCACTAAG
TAAACAAATCTTTTGGGAGCAGATAAAACCAAATTCAAAATTCAAAATATAGTCCTTTTC
TGCAACGATTTGATTGGCTCATTCAAGCCCATCAGTATGAAACAAGGCGAAGAAAGAACT
TAAGAAATCGAAAAGATATTGCCTAAGATTAAATTATTAGAAAAAGATCTCAATAAAAAG
GCCCATTTCTTCAACAACTCTTTAACTTTGGCTGATATCTATGCTTACTGCATTATTGAT
AATTTCTAACAATTAGGTGGTGACTCCTACAAGCCATTTGAGGAATCATTCAAAGCTTTC
TTAGATGCCTTTAGAAGTATTCCCGAAATCAAAGCTTACATCGAGTCTGATCGTTGTACT
AGATTCTAATAATAATGA