Identifiers and Description

Gene Model Identifier

TTHERM_00490880

Standard Name

GST15 (Glutathione S-transferase mu 15, TtGSTm15, GSTm15)

Aliases

PreTt08393 | 60.m00190

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00490880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04322.12.998830401637127e-79glutathione S-transferase doma
in-containing protein (219 aa)
OxytrichaContig16299.0.g156.001122775063233e-17Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02803170.0004000184047659232DDB_G0280317 on chromosome: 3
position 3248423 to 3249124

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00490880(coding)
ATGGGTTGTGGTTCTAGTTCAATTTAAGTTGCTGAAGTACCTAACTGTAATAAGTAATTA
TTATTGGGATATTGGGATATTCCTCTAAGAGCTTAACCAATAAGATACCTTCTCGAATTA
GGTCACTTTCCTTACACTGAAAAAAGGTATGCATAGAAAGATGCTCAAGAATGGTTTGGC
AAAGATAAATAAAATCTTGGTTTAGAATTCCCTAACCTTCCTTATATCACTCATGGGGAT
TATCATTTAACCGAAGCAGCTAATATTGCTAATTATGTCATAGAAATTACTTGCTAATAA
AACCTATTAGGATGTGGAGATGATAAATACAGAATTGGAAATATTAGATATGTCTGCGAT
GGCTTGATTATTGATGTTTTCAAGACTTTAAAAATGACTGCTGAAGAAAAATAAAAGCTC
TTAGAAAATAATATTATTCCTGATCTCTACTCATTGAATGAAGCACTTGGTGAAAAAACT
TACTTCTTCGGTAGATTAACTATTGCAGATGTTTATGCCTACTGCGCATTTGTCAACTTC
AAGTTATTCTTCCCAAATGAATATAAATAGTTTGCTAGCTCATTTGATCACCTAATAATC
AATTTTGAAGCTATTCCCGAAATTTAAGCTTATCAAAAATCAGATAGATTCCCTAAATTT
TAATTATGA


>TTHERM_00490880(protein)
MGCGSSSIQVAEVPNCNKQLLLGYWDIPLRAQPIRYLLELGHFPYTEKRYAQKDAQEWFG
KDKQNLGLEFPNLPYITHGDYHLTEAANIANYVIEITCQQNLLGCGDDKYRIGNIRYVCD
GLIIDVFKTLKMTAEEKQKLLENNIIPDLYSLNEALGEKTYFFGRLTIADVYAYCAFVNF
KLFFPNEYKQFASSFDHLIINFEAIPEIQAYQKSDRFPKFQL


>TTHERM_00490880(gene)
ATGGGTTGTGGTTCTAGTTCAATTTAAGTTGCTGAAGTACCTAACTGTAATAAGTAATTA
TTATTGGGATATTGGGATATTCCTCTAAGAGCTTAACCAATAAGATACCTTCTCGAATTA
GGTCACTTTCCTTACACTGAAAAAAGGTATGCATAGAAAGATGCTCAAGAATGGTTTGGC
AAAGATAAATAAAATCTTGGTTTAGAATTCCCTAACCTTCCTTATATCACTCATGGGGAT
TATCATTTAACCGAAGCAGCTAATATTGCTAATTATGTCATAGAAATTACTTGCTAATAA
AACCTATTAGGATGTGGAGATGATAAATACAGAATTGGAAATATTAGATATGTCTGCGAT
GGCTTGATTATTGATGTTTTCAAGACTTTAAAAATGACTGCTGAAGAAAAATAAAAGCTC
TTAGAAAATAATATTATTCCTGATCTCTACTCATTGAATGAAGCACTTGGTGAAAAAACT
TACTTCTTCGGTAGATTAACTATTGCAGATGTTTATGCCTACTGCGCATTTGTCAACTTC
AAGTTATTCTTCCCAAATGAATATAAATAGTTTGCTAGCTCATTTGATCACCTAATAATC
AATTTTGAAGCTATTCCCGAAATTTAAGCTTATCAAAAATCAGATAGATTCCCTAAATTT
TAATTATGA