Identifiers and Description

Gene Model Identifier

TTHERM_00490870

Standard Name

GST14 (Glutathione S-transferase mu 14, TtGSTm14, GSTm14)

Aliases

PreTt08392 | 60.m00189

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.9%

TetraMine Data

TTHERM_00490870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04322.18.998448382613942e-77glutathione S-transferase doma
in-containing protein (219 aa)
OxytrichaContig16299.0.g159.995317835403734e-19Glutathione S-transferase, N-t
erminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00490870(coding)
ATGGGCTGCAATCAAAGTTCTAGTGAAAACACTATTATCTCTTCAAATGCAAGAAAGTAG
TTGCTTTTAGGATATTGGAATATTCCTTTGAGAGCATAACCTATTAGGTATATTTTAGAA
TTGGCTTAATACCCATACAGTGAAAAGAAATATTCCTAAAAAGAAGCCCAAGAATGGTTT
GGTAATGATAAATAAAATCTTGGATTGGAATTCCCTAACCTTCCTTACATTTTTCATGGT
GATTATCATTTAACTGAAGCTTCTAACATTGCTAATTATGTTTTAGAAATTACTTGCTAG
TAATATCTTTTAGGTTGTGGAGATGACAAATTCAGAATTGGAAACATAAGATATGTCTGT
GATGGGTTGATCATTGATGTTTTCAAGACTTTAAAAATGACTCCTGAAGAAAAATAAAAG
CTCTTAGAAAATAATATAATTCCTGATCTATACTCATTAAAGGAAGCACTTGGTGAAAAG
ACTTACTTTTTTGGAAGACTGACTGTTGCAGATATTTATGCCTACTGCGCTTTTGTTAAC
TTCAAGCTTTTCTTCCCAAATGAGTACAAATAATTTGCTAGTTCATTTAATAACTTGATA
ATAAACTTCGAAGCTATCCCTGAAATCTAAGCTTATCAAAAATCAGATAGATTCCCTAAA
TTTTAATTATGA


>TTHERM_00490870(protein)
MGCNQSSSENTIISSNARKQLLLGYWNIPLRAQPIRYILELAQYPYSEKKYSQKEAQEWF
GNDKQNLGLEFPNLPYIFHGDYHLTEASNIANYVLEITCQQYLLGCGDDKFRIGNIRYVC
DGLIIDVFKTLKMTPEEKQKLLENNIIPDLYSLKEALGEKTYFFGRLTVADIYAYCAFVN
FKLFFPNEYKQFASSFNNLIINFEAIPEIQAYQKSDRFPKFQL


>TTHERM_00490870(gene)
ATGGGCTGCAATCAAAGTTCTAGTGAAAACACTATTATCTCTTCAAATGCAAGAAAGTAG
TTGCTTTTAGGATATTGGAATATTCCTTTGAGAGCATAACCTATTAGGTATATTTTAGAA
TTGGCTTAATACCCATACAGTGAAAAGAAATATTCCTAAAAAGAAGCCCAAGAATGGTTT
GGTAATGATAAATAAAATCTTGGATTGGAATTCCCTAACCTTCCTTACATTTTTCATGGT
GATTATCATTTAACTGAAGCTTCTAACATTGCTAATTATGTTTTAGAAATTACTTGCTAG
TAATATCTTTTAGGTTGTGGAGATGACAAATTCAGAATTGGAAACATAAGATATGTCTGT
GATGGGTTGATCATTGATGTTTTCAAGACTTTAAAAATGACTCCTGAAGAAAAATAAAAG
CTCTTAGAAAATAATATAATTCCTGATCTATACTCATTAAAGGAAGCACTTGGTGAAAAG
ACTTACTTTTTTGGAAGACTGACTGTTGCAGATATTTATGCCTACTGCGCTTTTGTTAAC
TTCAAGCTTTTCTTCCCAAATGAGTACAAATAATTTGCTAGTTCATTTAATAACTTGATA
ATAAACTTCGAAGCTATCCCTGAAATCTAAGCTTATCAAAAATCAGATAGATTCCCTAAA
TTTTAATTATGA