Identifiers and Description

Gene Model Identifier

TTHERM_00602860

Standard Name

GST13 (Glutathione S-transferase mu 13, TtGSTm13, GSTm13)

Aliases

PreTt27338 | 84.m00099

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00602860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15522.15.998052087146005e-105glutathione S-transferase doma
in-containing protein (221 aa)
OxytrichaContig12816.0.g911.999598840915195e-17Glutathione S-transferase, N-t
erminal domain
WormBaseWBGene000017600.00020003864201578029locus:gst-12 status:Confirme
d UniProt:Q93695 protein_i
d:CAB02288.1
DictyBaseDDB_G02740810.00020003864201578029DDB_G0274081 on chromosome: 2
position 3748941 to 3749724

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00602860(coding)
ATGGGCTGCTCTGGTTCTTCCGCTGTTAAGGATAAAGACTGTATTAATGAAAAGATTGTA
TTAGGTTATTGGGCTGTACACTTATAAGGTCAACCTGCCAGATACGTCTTAGAATTAGCT
GGCATTCCATATGAAGACAGATTATACACCATGTAAAATCGTGCTGACTGGTTCGAAAAA
GATAAACAAACTTTGGGTTTTGATTATCCTAACCTTCCTTATATTATTCATGGCGACTTC
AAAATTACTGAAAGCCAGAACGTTGTAAATTATGTCATCGAAGTAACCAACCAATAGAAA
CTTCTAGGTGAAGGTAAGGATAAATACAGAGTCGGTCACGTTAGATATGTCTGTTAAGAA
ATACTTGGCAAACTTTTTGGAGCAATTATGAAGGAAAATGCTGAAGAGAAATAAAATGCC
ATCCAAAACGACGTCCTCCCCAAAGCCAGGCTTGTTTAAACCTACCTTGGATCCCAAAAT
AAATTCTGCAGTGAACTCACTATTGCCGATATCTATGCTTACGTCTTTTTCTTCAACTTA
AAAAAGAAAGCTCCTGAAGCCTACGCCGAATTTGCTGCTCAAATCGACCCCTTACTTTAA
AACTTCGAAAGCATCCCCAATATTAAAAAATACTAAGAATCTGAACGTTTTGCTAAAATC
AACAATTGA


>TTHERM_00602860(protein)
MGCSGSSAVKDKDCINEKIVLGYWAVHLQGQPARYVLELAGIPYEDRLYTMQNRADWFEK
DKQTLGFDYPNLPYIIHGDFKITESQNVVNYVIEVTNQQKLLGEGKDKYRVGHVRYVCQE
ILGKLFGAIMKENAEEKQNAIQNDVLPKARLVQTYLGSQNKFCSELTIADIYAYVFFFNL
KKKAPEAYAEFAAQIDPLLQNFESIPNIKKYQESERFAKINN


>TTHERM_00602860(gene)
ATGGGCTGCTCTGGTTCTTCCGCTGTTAAGGATAAAGACTGTATTAATGAAAAGATTGTA
TTAGGTTATTGGGCTGTACACTTATAAGGTCAACCTGCCAGATACGTCTTAGAATTAGCT
GGCATTCCATATGAAGACAGATTATACACCATGTAAAATCGTGCTGACTGGTTCGAAAAA
GATAAACAAACTTTGGGTTTTGATTATCCTAACCTTCCTTATATTATTCATGGCGACTTC
AAAATTACTGAAAGCCAGAACGTTGTAAATTATGTCATCGAAGTAACCAACCAATAGAAA
CTTCTAGGTGAAGGTAAGGATAAATACAGAGTCGGTCACGTTAGATATGTCTGTTAAGAA
ATACTTGGCAAACTTTTTGGAGCAATTATGAAGGAAAATGCTGAAGAGAAATAAAATGCC
ATCCAAAACGACGTCCTCCCCAAAGCCAGGCTTGTTTAAACCTACCTTGGATCCCAAAAT
AAATTCTGCAGTGAACTCACTATTGCCGATATCTATGCTTACGTCTTTTTCTTCAACTTA
AAAAAGAAAGCTCCTGAAGCCTACGCCGAATTTGCTGCTCAAATCGACCCCTTACTTTAA
AACTTCGAAAGCATCCCCAATATTAAAAAATACTAAGAATCTGAACGTTTTGCTAAAATC
AACAATTGA