Identifiers and Description

Gene Model Identifier

TTHERM_00630270

Standard Name

GST12 (Glutathione S-transferase mu 12, TtGSTm12, GSTm12)

Aliases

PreTt06542 | 89.m00136 | 3831.m01436

Description

GST12 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.9%

TetraMine Data

TTHERM_00630270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04321.14.997748715790535e-135glutathione S-transferase doma
in-containing protein (209 aa)
OxytrichaContig16299.0.g151.000116773704384e-19Glutathione S-transferase, N-t
erminal domain
Stentor CoeruleusSteCoe_298040.0000003059023205018258

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00630270(coding)
ATGTCTTCTAATACTATCACTTTAGGCTACTGGGCTCTCCCTTTAAGAGGATAACCAATT
AGATATATTTTTGAATTAGCTAAATTTCCCTATTAACAAACTCTTTACACTTCTGCCACT
GCATCTAACTGGTTTGGTAAAGACAAACAAGAACTCGGATTAGATTTCCCCAATTTGCCT
TATCTTATTAAAGGAGATTTCAAGATTACTGAATCTTAAAATATTGTTAACTATGCAATT
GATATCACTAAATAGCAACATTTATTAGGAACAGGTTAAAAAACATTCAAAATTGACAAT
ATTAGATTCTTCTGCGACGAATTGACTAGCAAGGTATTTTTGGCCACAAGAAAAAGTGGA
GAAGAAAAGACAACTGAAATAAACAACGTTTTAATTCCTAAGTTTAAATACTTGCACAAG
TAATTAGGAAACAATGTTTATTTCTTTGACAACAAGTTATCTCTTGCTGATATATTTGCC
TACACTGCAATCAATGTCTTCAAGCTTAAGTTCAATGAAGAATACTAACAATTTTCATCA
ACCTTCGACCCCTTCATGAAAAACTTCGAAGAAATACCTTTAATTAAAGAATACCACAAC
TCTGATCGTTATCCTAAAATGCCTTGA


>TTHERM_00630270(protein)
MSSNTITLGYWALPLRGQPIRYIFELAKFPYQQTLYTSATASNWFGKDKQELGLDFPNLP
YLIKGDFKITESQNIVNYAIDITKQQHLLGTGQKTFKIDNIRFFCDELTSKVFLATRKSG
EEKTTEINNVLIPKFKYLHKQLGNNVYFFDNKLSLADIFAYTAINVFKLKFNEEYQQFSS
TFDPFMKNFEEIPLIKEYHNSDRYPKMP


>TTHERM_00630270(gene)
ATGTCTTCTAATACTATCACTTTAGGCTACTGGGCTCTCCCTTTAAGAGGATAACCAATT
AGATATATTTTTGAATTAGCTAAATTTCCCTATTAACAAACTCTTTACACTTCTGCCACT
GCATCTAACTGGTTTGGTAAAGACAAACAAGAACTCGGATTAGATTTCCCCAATTTGCCT
TATCTTATTAAAGGAGATTTCAAGATTACTGAATCTTAAAATATTGTTAACTATGCAATT
GATATCACTAAATAGCAACATTTATTAGGAACAGGTTAAAAAACATTCAAAATTGACAAT
ATTAGATTCTTCTGCGACGAATTGACTAGCAAGGTATTTTTGGCCACAAGAAAAAGTGGA
GAAGAAAAGACAACTGAAATAAACAACGTTTTAATTCCTAAGTTTAAATACTTGCACAAG
TAATTAGGAAACAATGTTTATTTCTTTGACAACAAGTTATCTCTTGCTGATATATTTGCC
TACACTGCAATCAATGTCTTCAAGCTTAAGTTCAATGAAGAATACTAACAATTTTCATCA
ACCTTCGACCCCTTCATGAAAAACTTCGAAGAAATACCTTTAATTAAAGAATACCACAAC
TCTGATCGTTATCCTAAAATGCCTTGA