Identifiers and Description

Gene Model Identifier

TTHERM_00405450

Standard Name

GST11 (Glutathione S-transferase mu 11, TtGSTm11, GSTm11)

Aliases

PreTt12792 | 43.m00310 | 3713.m00132

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00405450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04321.13.999200205084497e-101glutathione S-transferase doma
in-containing protein (209 aa)
OxytrichaContig16299.0.g155.998633383648922e-18Glutathione S-transferase, N-t
erminal domain
DictyBaseDDB_G02681380.000005998506718272351DDB_G0268138 on chromosome: 1
position 1528262 to 1528973
WormBaseWBGene000211270.0000899730839127287status:Confirmed UniProt:O45
010 protein_id:CCD73396.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00405450(coding)
ATGTCTTCATTAACTTTAAATTTAGGATACTGGGCTTATCCATTAAGAGGATAACCTATA
AGATATCTTCTTGAACTAGCTCAATATCCATACTAATAAACTAACTATACTTTTGAGGGA
GCTAATGACTGGTTCGAAAAAGATAAAAAAGAACTTGGTCTAGATTTTCCTAACTTGCCT
TACCTCATACATGGCGATTTTAAGATCACCGAGTCTTAAAACATTGTCGATTATGTTTTG
GATCTCACTAAATAGCATCATTTATTAGGATCTGGACTAACAAAATTTCAGATAGATAAC
GTCAGATTCCTCTGTAATGAGTTGATTTCCAAAATATTCTTAGCATCAACGAAAACAGGA
GAAGAAAAGAAGGCTGAAATCAACAACTCTGTTACTCCTAAATTTAAGCGCTTATAAGCT
GTTTTAGGAAACAAAAAGTTTTTCTTTGAAGATAAGTTAACTTTAGCTGATATCTATGCT
TACACAGCAATAAATGCACTGTAACATCTATTGAATGATGAATACAAGTAATTTGCTTAA
GCTTTTGGTCCTTTTATGAAAAACTTTGAAGAAATTCCTTTAATTAAGGCTTACCATAGC
TCAACCAGATATCCTAGATTTAAATGA


>TTHERM_00405450(protein)
MSSLTLNLGYWAYPLRGQPIRYLLELAQYPYQQTNYTFEGANDWFEKDKKELGLDFPNLP
YLIHGDFKITESQNIVDYVLDLTKQHHLLGSGLTKFQIDNVRFLCNELISKIFLASTKTG
EEKKAEINNSVTPKFKRLQAVLGNKKFFFEDKLTLADIYAYTAINALQHLLNDEYKQFAQ
AFGPFMKNFEEIPLIKAYHSSTRYPRFK


>TTHERM_00405450(gene)
ATGTCTTCATTAACTTTAAATTTAGGATACTGGGCTTATCCATTAAGAGGATAACCTATA
AGATATCTTCTTGAACTAGCTCAATATCCATACTAATAAACTAACTATACTTTTGAGGGA
GCTAATGACTGGTTCGAAAAAGATAAAAAAGAACTTGGTCTAGATTTTCCTAACTTGCCT
TACCTCATACATGGCGATTTTAAGATCACCGAGTCTTAAAACATTGTCGATTATGTTTTG
GATCTCACTAAATAGCATCATTTATTAGGATCTGGACTAACAAAATTTCAGATAGATAAC
GTCAGATTCCTCTGTAATGAGTTGATTTCCAAAATATTCTTAGCATCAACGAAAACAGGA
GAAGAAAAGAAGGCTGAAATCAACAACTCTGTTACTCCTAAATTTAAGCGCTTATAAGCT
GTTTTAGGAAACAAAAAGTTTTTCTTTGAAGATAAGTTAACTTTAGCTGATATCTATGCT
TACACAGCAATAAATGCACTGTAACATCTATTGAATGATGAATACAAGTAATTTGCTTAA
GCTTTTGGTCCTTTTATGAAAAACTTTGAAGAAATTCCTTTAATTAAGGCTTACCATAGC
TCAACCAGATATCCTAGATTTAAATGA