Identifiers and Description

Gene Model Identifier

TTHERM_00221130

Standard Name

GRT2 (GRanule Tip)

Aliases

PreTt22441 | 18.m00467 | 3701.m00224

Description

C-terminal crystallin fold protein; domain structure identical to GRT1, suggesting localization in dense core granules; contains additional tandem copies of a 150-residue motif shared by CCF3, CCF4, GRT1, and GRT2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 70.9%

TetraMine Data

TTHERM_00221130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06794.19.997093137033517e-262hypothetical protein (718 aa)
OxytrichaContig18293.0.g1060.0004999512321494991hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00221130(coding)
ATGAGAAAATATTAAATCATTATTGCAACACTACTAGTTGTATCTGTAGTTGCTGATGTA
AAATTAGTAACTTAAGAATTCACAGCTAAGAATTTCGATAGCTCAGCCGTATCTGGTTGG
TAAGTTACAGGAAACAAAAATAACAATTTAGTTTCTAATTGTGGTGATCAATCTGTTTTT
GGTGGTTATGATACTTTTGGTGCTCGTGCTAGCGCTAGCAAAGACTACAATTCTGGAGTT
GATCATTTTGAACTTACATTCAATTTCGATTTATACACTATCGATTCTTGGGATAATGAA
GTCTTTAATTTATACGTTGATGACTAGTTAGTTTATAGTTTATAAGCTTTGTACAATTAA
CCCTCTCCCAAACCAATTAATGGTACTTGTGGTTAAGTAGGAATGTTAGATAGATTGTAA
TCAGTCACTGTTAAGCTTAATCACTACAGAAAGTAATTCAATGTTAGACTAACCACTACT
CTTGATTAGGACCCTAGTGATGAATCTTGGGCTATCAAGAATTTCTAGATTCTCGCAAGA
TACGGTGGTGGTAACATTTAATTAATTAGTGAAGAATATAATTAAGACTCATTTTAGAGT
GATGCTTCTACATGGAATATTGTCAACGTTTAACCAGTATTTACTAAATGTGGTGATGGT
ACCAAAATTTTCGGTGGTTACAATGCTATGGGTAAGGATTCTCTCGTTTCTAAAACCTAC
AATAATTTACCCCCTCATTACGGTGTATTATTTGCCTTTGATCTCTGGCTTATTGATTCA
CCTGAAGGTAATGACTACGTTTAAGTCATAGTTGATGGCTAAATATAAAGATTCTACAGA
CCAGATTATTAATATGAAGACCTTTAAAATTTCATATGCGGTGTTTAAGGATGGTCTGAA
AGAATTATTAAAGTTAACCTTTTCGTCCCTCATAGAGGCCCTTCAATTAACATTGCATTT
AGAGGTGTTTTTGATGAAGGAAAAGACAATGAATCCTTCGGTTTCAGAAACCTCAGAATT
GTTTCTCTTGGTTGCTCTTCAGCAAGATGCCAATAAGTTTCAAACGAATTCTATCAATAA
ACTTTTGCTGATCCTTAAGGCTGGACAGATGAAGGTGGAAATACTCTTGTTTCTCCTTTC
AAAACTTGCTCATAAGCTACATTATTTGGACCTTTCTCAGTTCCTATTGAAAAAACTTAT
GACTCACTCTAACCCCACTCTGGTGTAAGAATCTTCTTAAGAGTCTTTGCTCTTGGAGAT
TGGACAAACTCTCAAACTGGTATGAAATTCTTCGTTAACGATGTCTTAACCACTCCTAAA
GTTGCTGCAGAATTTGCTAAGAATAAAATTTGTGATGCAGACACAGAAAGCGTTAGAAAC
TACTTCATTGATATACCTCATTCTAATTCTATCTTAGAACTCGATATTAAGCCAGTGAAC
TTTGTAGGAAGCACTAAATATTCTATCAGAGATTTATCCTTAACAGCTTACTTCGAAGAA
GGTTAAACTTTGGTTTCATCAGAATTCACCTCAGTCAACTTCAATAGTGCCGCTGGATGG
ACTATTAATGGAAACACAAATTCAGTAACTACATCAAGATGTGGTAAATACTCTCTCTTT
GGTGGTTTTAATGCTTTTGGAAGAAGAACATCTGCCTCTAAGTTATATAACTCACTTCCT
GATCACGACTACGTTGTCATCGTTTTCACCGTTTACTTGATTGATACTTGGGAAAGAGAA
AACTTTAACATCGCTGTAGATGATGTCATCATAAAGAGAATTACTAAATCAGAAACTTGG
AATGGACATTAGCATTTGTGCGGTAGAGGTGATTCCATGGAAGAAACCTACACTTTCTAA
CTTAATGTACCTCATACTGCTAGTACAGTTAAGCTTACTTTTAGTGATGAACTTGATCAA
ACAACAGATGATGAATCTTGGGGTATTAGAGATTTATCCATTCTTGTTGGTAAAAACCAA
GGTGCTGGTTTTGTTTCTTAAGATGATACTAACTGCATTTAAATTTACACTTAATGCAAT
TACGATGGCTTATCTCTTGCTGTCTGTAATAATATCCCTGATTTAGGTACTATTGGATGG
ACTAAGCCAATCAAATCTATTAAAATTCCTTAAGGAAAGAGTATTTAAGCCTACAAACTT
CCTAATTACTAAGGAGATTCCAAGTAATTCACTTCTTCTCAAGATTGTTTAACTGGCCAA
AACTATCTTCTTATTAACAAAGCTTTCAACATTGATGTTGAACCTGAAACAAAATTAAAA
CACTAAAGAAGAATTTGA


>TTHERM_00221130(protein)
MRKYQIIIATLLVVSVVADVKLVTQEFTAKNFDSSAVSGWQVTGNKNNNLVSNCGDQSVF
GGYDTFGARASASKDYNSGVDHFELTFNFDLYTIDSWDNEVFNLYVDDQLVYSLQALYNQ
PSPKPINGTCGQVGMLDRLQSVTVKLNHYRKQFNVRLTTTLDQDPSDESWAIKNFQILAR
YGGGNIQLISEEYNQDSFQSDASTWNIVNVQPVFTKCGDGTKIFGGYNAMGKDSLVSKTY
NNLPPHYGVLFAFDLWLIDSPEGNDYVQVIVDGQIQRFYRPDYQYEDLQNFICGVQGWSE
RIIKVNLFVPHRGPSINIAFRGVFDEGKDNESFGFRNLRIVSLGCSSARCQQVSNEFYQQ
TFADPQGWTDEGGNTLVSPFKTCSQATLFGPFSVPIEKTYDSLQPHSGVRIFLRVFALGD
WTNSQTGMKFFVNDVLTTPKVAAEFAKNKICDADTESVRNYFIDIPHSNSILELDIKPVN
FVGSTKYSIRDLSLTAYFEEGQTLVSSEFTSVNFNSAAGWTINGNTNSVTTSRCGKYSLF
GGFNAFGRRTSASKLYNSLPDHDYVVIVFTVYLIDTWERENFNIAVDDVIIKRITKSETW
NGHQHLCGRGDSMEETYTFQLNVPHTASTVKLTFSDELDQTTDDESWGIRDLSILVGKNQ
GAGFVSQDDTNCIQIYTQCNYDGLSLAVCNNIPDLGTIGWTKPIKSIKIPQGKSIQAYKL
PNYQGDSKQFTSSQDCLTGQNYLLINKAFNIDVEPETKLKHQRRI


>TTHERM_00221130(gene)
ATGAGAAAATATTAAATCATTATTGCAACACTACTAGTTGTATCTGTAGTTGCTGATGTA
AAATTAGTAACTTAAGAATTCACAGCTAAGAATTTCGATAGCTCAGCCGTATCTGGTTGG
TAAGTTACAGGAAACAAAAATAACAATTTAGTTTCTAATTGTGGTGATCAATCTGTTTTT
GGTGGTTATGATACTTTTGGTGCTCGTGCTAGCGCTAGCAAAGACTACAATTCTGGAGTT
GATCATTTTGAACTTACATTCAATTTCGATTTATACACTATCGATTCTTGGGGTAAATTC
ATCTTAATAATCAAAAAAAATATTTCCCATTTTTTAAGTGCATTTTAATACCGTAAAACC
TCGTTAAGGATAACAAACGAGTTGAGAGGTAAGAGGTAAGAGTCTTAAAATTCTAAACCC
CGATAACTCGAACATTTTTTGAATTCGAGGGTTGCTAGTTAGCGAGGTCTTATGGTATTT
AATTATTAGTGAGTTACCATATTTGTGAATAATAAAGAATTGCAAATGACGATTAAACAT
AATATTAACAACATTTTTGAATAAATTAGATAATGAAGTCTTTAATTTATACGTTGATGA
CTAGTTAGGTACTATATTTATTCATCAAACTCCAATTTTTAATATATTTGATACCTATAA
AATATAGTTTATAGTTTATAAGCTTTGTACAATTAACCCTCTCCCAAACCAATTAATGGT
ACTTGTGGTTAAGTAGGAATGTTAGATAGATTGTAATCAGTCACTGTTAAGCTTAATCAC
TACAGAAAGTAATTCAATGTTAGACTAACCACTACTCTTGATTAGGACCCTAGTAAAATG
AATTTTTTAAGTTTATGGTTTATATAATATTTTAATATTAATTTATTAGGTGATGAATCT
TGGGCTATCAAGAATTTCTAGATTCTCGCAAGATACGGTGGTGGTAACATTTAATTAATT
AGTGAAGAATATAATTAAGACTCATTTTAGAGTGATGCTTCTACATGGAATATTGTCAAC
GTTTAACCAGTATTTACTAAATGGTAATTATTATATTACTCCATCTTACTAATATATTAA
TTCACTCATTGATTCATTCATTTATTAATTATTTATCAACTCATTTGTTAAATTTATATA
TTTATTTGCAATAGTGGTGATGGTACCAAAATTTTCGGTGGTTACAATGCTATGGGTAAG
GATTCTCTCGTTTCTAAAACCTACAATAATTTACCCCCTCATTACGGTGTATTATTTGCC
TTTGATCTCTGGCTTATTGATTCACCTGAAGGTAATGACTACGTTTAAGTCATAGTTGAT
GGCTAAATATAAAGATTCTACAGACCAGATTATTAATATGAAGACCTTTAAAATTTCATA
TGCGGTGTTTAAGGATGGTCTGAAAGAATTATTAAAGTTAACCTTTTCGTCCCTCATAGA
GGCCCTTCAATTAACATTGCATTTAGAGGTGTTTTTGATGAAGGAAAAGACAATGAATCC
TTCGGTTTCAGAAACCTCAGAATTGTTTCTCTTGGTTGCTCTTCAGCAAGATGCCAATAA
GTTTCAAACGAATTCTATCAATAAACTTTTGCTGATCCTTAAGGCTGGACAGATGAAGGT
GGAAATACTCTTGTTTCTCCTTTCAAAACTTGCTCATAAGCTACATTATTTGGACCTTTC
TCAGTTCCTATTGAAAAAACTTATGACTCACTCTAACCCCACTCTGGTGTAAGAATCTTC
TTAAGAGTCTTTGCTCTTGGAGATTGGACAAACTCTCAAACTGGTATGAAATTCTTCGTT
AACGATGTCTTAACCACTCCTAAAGTTGCTGCAGAATTTGCTAAGAATAAAATTTGTGAT
GCAGACACAGAAAGCGTTAGAAACTACTTCATTGATATACCTCATTCTAATTCTATCTTA
GAACTCGATATTAAGCCAGTGAACTTTGTAGGAAGCACTAAATATTCTATCAGAGATTTA
TCCTTAACAGCTTACTTCGAAGAAGGTTAAACTTTGGTTTCATCAGAATTCACCTCAGTC
AACTTCAATAGTGCCGCTGGATGGACTATTAATGGAAACACAAATTCAGTAACTACATCA
AGATGTGGTAAATACTCTCTCTTTGGTGGTTTTAATGCTTTTGGAAGAAGAACATCTGCC
TCTAAGTTATATAACTCACTTCCTGATCACGACTACGTTGTCATCGTTTTCACCGTTTAC
TTGATTGATACTTGGGAAGTAAAAAATTCTTTTAGTTTCCTATCTTTATCTTAATATTAA
AAATAATTTTATATATAGAGAGAAAACTTTAACATCGCTGTAGATGATGTCATCATAAAG
AGAATTACTAAATCAGAAACTTGGAATGGACATTAGCATTTGTGCGGTAGAGGTGATTCC
ATGGAAGAAACCTACACTTTCTAACTTAATGTACCTCATACTGCTAGTACAGTTAAGCTT
ACTTTTAGTGATGAACTTGATCAAACAACAGTATTAAATAAGATATTCTTTCTTAATCAA
TAATTCAATTTAAAAATTTAAACTAATATTAGGATGATGAATCTTGGGGTATTAGAGATT
TATCCATTCTTGTTGGTAAAAACCAAGGTGCTGGTTTTGTTTCTTAAGATGATACTAACT
GCATTTAAATTTACACTTAATGCAATTACGATGGCTTATCTCTTGCTGTCTGTAATAATA
TCCCTGATTTAGGTACTATTGGATGGACTAAGCCAATCAAATCTATTAAAATTCCTTAAG
GAAAGAGTATTTAAGCCTACAAACTTCCTAATTACTAAGGAGATTCCAAGTAATTCACTT
CTTCTCAAGATTGTTTAACTGGCCAAAACTATCTTCTTATTAACAAAGCTTTCAACATTG
ATGTTGAACCTGAAACAAAATTAAAACACTAAAGAAGAATTTGA