Identifiers and Description

Gene Model Identifier

TTHERM_00221130

Standard Name

GRT2 (GRanule Tip 2)

Aliases

PreTt22441 | 18.m00467 | 3701.m00224

Description

GRT2 granule tip protein; C-terminal crystallin fold protein; domain structure identical to GRT1- suggesting localization in dense core granules; contains additional tandem copies of a 150-residue motif shared by CCF3- CCF4- GRT1- and GRT2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 70.9%

TetraMine Data

TTHERM_00221130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06794.19.997093137033517e-262hypothetical protein (718 aa)
OxytrichaContig18293.0.g1060.0004999512321494991hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00221130(coding)
ATGAGAAAATATTAAATCATTATTGCAACACTACTAGTTGTATCTGTAGTTGCTGATGTA
AAATTAGTAACTTAAGAATTCACAGCTAAGAATTTCGATAGCTCAGCCGTATCTGGTTGG
TAAGTTACAGGAAACAAAAATAACAATTTAGTTTCTAATTGTGGTGATCAATCTGTTTTT
GGTGGTTATGATACTTTTGGTGCTCGTGCTAGCGCTAGCAAAGACTACAATTCTGGAGTT
GATCATTTTGAACTTACATTCAATTTCGATTTATACACTATCGATTCTTGGGATAATGAA
GTCTTTAATTTATACGTTGATGACTAGTTAGTTTATAGTTTATAAGCTTTGTACAATTAA
CCCTCTCCCAAACCAATTAATGGTACTTGTGGTTAAGTAGGAATGTTAGATAGATTGTAA
TCAGTCACTGTTAAGCTTAATCACTACAGAAAGTAATTCAATGTTAGACTAACCACTACT
CTTGATTAGGACCCTAGTGATGAATCTTGGGCTATCAAGAATTTCTAGATTCTCGCAAGA
TACGGTGGTGGTAACATTTAATTAATTAGTGAAGAATATAATTAAGACTCATTTTAGAGT
GATGCTTCTACATGGAATATTGTCAACGTTTAACCAGTATTTACTAAATGTGGTGATGGT
ACCAAAATTTTCGGTGGTTACAATGCTATGGGTAAGGATTCTCTCGTTTCTAAAACCTAC
AATAATTTACCCCCTCATTACGGTGTATTATTTGCCTTTGATCTCTGGCTTATTGATTCA
CCTGAAGGTAATGACTACGTTTAAGTCATAGTTGATGGCTAAATATAAAGATTCTACAGA
CCAGATTATTAATATGAAGACCTTTAAAATTTCATATGCGGTGTTTAAGGATGGTCTGAA
AGAATTATTAAAGTTAACCTTTTCGTCCCTCATAGAGGCCCTTCAATTAACATTGCATTT
AGAGGTGTTTTTGATGAAGGAAAAGACAATGAATCCTTCGGTTTCAGAAACCTCAGAATT
GTTTCTCTTGGTTGCTCTTCAGCAAGATGCCAATAAGTTTCAAACGAATTCTATCAATAA
ACTTTTGCTGATCCTTAAGGCTGGACAGATGAAGGTGGAAATACTCTTGTTTCTCCTTTC
AAAACTTGCTCATAAGCTACATTATTTGGACCTTTCTCAGTTCCTATTGAAAAAACTTAT
GACTCACTCTAACCCCACTCTGGTGTAAGAATCTTCTTAAGAGTCTTTGCTCTTGGAGAT
TGGACAAACTCTCAAACTGGTATGAAATTCTTCGTTAACGATGTCTTAACCACTCCTAAA
GTTGCTGCAGAATTTGCTAAGAATAAAATTTGTGATGCAGACACAGAAAGCGTTAGAAAC
TACTTCATTGATATACCTCATTCTAATTCTATCTTAGAACTCGATATTAAGCCAGTGAAC
TTTGTAGGAAGCACTAAATATTCTATCAGAGATTTATCCTTAACAGCTTACTTCGAAGAA
GGTTAAACTTTGGTTTCATCAGAATTCACCTCAGTCAACTTCAATAGTGCCGCTGGATGG
ACTATTAATGGAAACACAAATTCAGTAACTACATCAAGATGTGGTAAATACTCTCTCTTT
GGTGGTTTTAATGCTTTTGGAAGAAGAACATCTGCCTCTAAGTTATATAACTCACTTCCT
GATCACGACTACGTTGTCATCGTTTTCACCGTTTACTTGATTGATACTTGGGAAAGAGAA
AACTTTAACATCGCTGTAGATGATGTCATCATAAAGAGAATTACTAAATCAGAAACTTGG
AATGGACATTAGCATTTGTGCGGTAGAGGTGATTCCATGGAAGAAACCTACACTTTCTAA
CTTAATGTACCTCATACTGCTAGTACAGTTAAGCTTACTTTTAGTGATGAACTTGATCAA
ACAACAGATGATGAATCTTGGGGTATTAGAGATTTATCCATTCTTGTTGGTAAAAACCAA
GGTGCTGGTTTTGTTTCTTAAGATGATACTAACTGCATTTAAATTTACACTTAATGCAAT
TACGATGGCTTATCTCTTGCTGTCTGTAATAATATCCCTGATTTAGGTACTATTGGATGG
ACTAAGCCAATCAAATCTATTAAAATTCCTTAAGGAAAGAGTATTTAAGCCTACAAACTT
CCTAATTACTAAGGAGATTCCAAGTAATTCACTTCTTCTCAAGATTGTTTAACTGGCCAA
AACTATCTTCTTATTAACAAAGCTTTCAACATTGATGTTGAACCTGAAACAAAATTAAAA
CACTAAAGAAGAATTTGA


>TTHERM_00221130(protein)
MRKYQIIIATLLVVSVVADVKLVTQEFTAKNFDSSAVSGWQVTGNKNNNLVSNCGDQSVF
GGYDTFGARASASKDYNSGVDHFELTFNFDLYTIDSWDNEVFNLYVDDQLVYSLQALYNQ
PSPKPINGTCGQVGMLDRLQSVTVKLNHYRKQFNVRLTTTLDQDPSDESWAIKNFQILAR
YGGGNIQLISEEYNQDSFQSDASTWNIVNVQPVFTKCGDGTKIFGGYNAMGKDSLVSKTY
NNLPPHYGVLFAFDLWLIDSPEGNDYVQVIVDGQIQRFYRPDYQYEDLQNFICGVQGWSE
RIIKVNLFVPHRGPSINIAFRGVFDEGKDNESFGFRNLRIVSLGCSSARCQQVSNEFYQQ
TFADPQGWTDEGGNTLVSPFKTCSQATLFGPFSVPIEKTYDSLQPHSGVRIFLRVFALGD
WTNSQTGMKFFVNDVLTTPKVAAEFAKNKICDADTESVRNYFIDIPHSNSILELDIKPVN
FVGSTKYSIRDLSLTAYFEEGQTLVSSEFTSVNFNSAAGWTINGNTNSVTTSRCGKYSLF
GGFNAFGRRTSASKLYNSLPDHDYVVIVFTVYLIDTWERENFNIAVDDVIIKRITKSETW
NGHQHLCGRGDSMEETYTFQLNVPHTASTVKLTFSDELDQTTDDESWGIRDLSILVGKNQ
GAGFVSQDDTNCIQIYTQCNYDGLSLAVCNNIPDLGTIGWTKPIKSIKIPQGKSIQAYKL
PNYQGDSKQFTSSQDCLTGQNYLLINKAFNIDVEPETKLKHQRRI


>TTHERM_00221130(gene)
ATGAGAAAATATTAAATCATTATTGCAACACTACTAGTTGTATCTGTAGTTGCTGATGTA
AAATTAGTAACTTAAGAATTCACAGCTAAGAATTTCGATAGCTCAGCCGTATCTGGTTGG
TAAGTTACAGGAAACAAAAATAACAATTTAGTTTCTAATTGTGGTGATCAATCTGTTTTT
GGTGGTTATGATACTTTTGGTGCTCGTGCTAGCGCTAGCAAAGACTACAATTCTGGAGTT
GATCATTTTGAACTTACATTCAATTTCGATTTATACACTATCGATTCTTGGGGTAAATTC
ATCTTAATAATCAAAAAAAATATTTCCCATTTTTTAAGTGCATTTTAATACCGTAAAACC
TCGTTAAGGATAACAAACGAGTTGAGAGGTAAGAGGTAAGAGTCTTAAAATTCTAAACCC
CGATAACTCGAACATTTTTTGAATTCGAGGGTTGCTAGTTAGCGAGGTCTTATGGTATTT
AATTATTAGTGAGTTACCATATTTGTGAATAATAAAGAATTGCAAATGACGATTAAACAT
AATATTAACAACATTTTTGAATAAATTAGATAATGAAGTCTTTAATTTATACGTTGATGA
CTAGTTAGGTACTATATTTATTCATCAAACTCCAATTTTTAATATATTTGATACCTATAA
AATATAGTTTATAGTTTATAAGCTTTGTACAATTAACCCTCTCCCAAACCAATTAATGGT
ACTTGTGGTTAAGTAGGAATGTTAGATAGATTGTAATCAGTCACTGTTAAGCTTAATCAC
TACAGAAAGTAATTCAATGTTAGACTAACCACTACTCTTGATTAGGACCCTAGTAAAATG
AATTTTTTAAGTTTATGGTTTATATAATATTTTAATATTAATTTATTAGGTGATGAATCT
TGGGCTATCAAGAATTTCTAGATTCTCGCAAGATACGGTGGTGGTAACATTTAATTAATT
AGTGAAGAATATAATTAAGACTCATTTTAGAGTGATGCTTCTACATGGAATATTGTCAAC
GTTTAACCAGTATTTACTAAATGGTAATTATTATATTACTCCATCTTACTAATATATTAA
TTCACTCATTGATTCATTCATTTATTAATTATTTATCAACTCATTTGTTAAATTTATATA
TTTATTTGCAATAGTGGTGATGGTACCAAAATTTTCGGTGGTTACAATGCTATGGGTAAG
GATTCTCTCGTTTCTAAAACCTACAATAATTTACCCCCTCATTACGGTGTATTATTTGCC
TTTGATCTCTGGCTTATTGATTCACCTGAAGGTAATGACTACGTTTAAGTCATAGTTGAT
GGCTAAATATAAAGATTCTACAGACCAGATTATTAATATGAAGACCTTTAAAATTTCATA
TGCGGTGTTTAAGGATGGTCTGAAAGAATTATTAAAGTTAACCTTTTCGTCCCTCATAGA
GGCCCTTCAATTAACATTGCATTTAGAGGTGTTTTTGATGAAGGAAAAGACAATGAATCC
TTCGGTTTCAGAAACCTCAGAATTGTTTCTCTTGGTTGCTCTTCAGCAAGATGCCAATAA
GTTTCAAACGAATTCTATCAATAAACTTTTGCTGATCCTTAAGGCTGGACAGATGAAGGT
GGAAATACTCTTGTTTCTCCTTTCAAAACTTGCTCATAAGCTACATTATTTGGACCTTTC
TCAGTTCCTATTGAAAAAACTTATGACTCACTCTAACCCCACTCTGGTGTAAGAATCTTC
TTAAGAGTCTTTGCTCTTGGAGATTGGACAAACTCTCAAACTGGTATGAAATTCTTCGTT
AACGATGTCTTAACCACTCCTAAAGTTGCTGCAGAATTTGCTAAGAATAAAATTTGTGAT
GCAGACACAGAAAGCGTTAGAAACTACTTCATTGATATACCTCATTCTAATTCTATCTTA
GAACTCGATATTAAGCCAGTGAACTTTGTAGGAAGCACTAAATATTCTATCAGAGATTTA
TCCTTAACAGCTTACTTCGAAGAAGGTTAAACTTTGGTTTCATCAGAATTCACCTCAGTC
AACTTCAATAGTGCCGCTGGATGGACTATTAATGGAAACACAAATTCAGTAACTACATCA
AGATGTGGTAAATACTCTCTCTTTGGTGGTTTTAATGCTTTTGGAAGAAGAACATCTGCC
TCTAAGTTATATAACTCACTTCCTGATCACGACTACGTTGTCATCGTTTTCACCGTTTAC
TTGATTGATACTTGGGAAGTAAAAAATTCTTTTAGTTTCCTATCTTTATCTTAATATTAA
AAATAATTTTATATATAGAGAGAAAACTTTAACATCGCTGTAGATGATGTCATCATAAAG
AGAATTACTAAATCAGAAACTTGGAATGGACATTAGCATTTGTGCGGTAGAGGTGATTCC
ATGGAAGAAACCTACACTTTCTAACTTAATGTACCTCATACTGCTAGTACAGTTAAGCTT
ACTTTTAGTGATGAACTTGATCAAACAACAGTATTAAATAAGATATTCTTTCTTAATCAA
TAATTCAATTTAAAAATTTAAACTAATATTAGGATGATGAATCTTGGGGTATTAGAGATT
TATCCATTCTTGTTGGTAAAAACCAAGGTGCTGGTTTTGTTTCTTAAGATGATACTAACT
GCATTTAAATTTACACTTAATGCAATTACGATGGCTTATCTCTTGCTGTCTGTAATAATA
TCCCTGATTTAGGTACTATTGGATGGACTAAGCCAATCAAATCTATTAAAATTCCTTAAG
GAAAGAGTATTTAAGCCTACAAACTTCCTAATTACTAAGGAGATTCCAAGTAATTCACTT
CTTCTCAAGATTGTTTAACTGGCCAAAACTATCTTCTTATTAACAAAGCTTTCAACATTG
ATGTTGAACCTGAAACAAAATTAAAACACTAAAGAAGAATTTGA