Identifiers and Description

Gene Model Identifier

TTHERM_00221120

Standard Name

GRT1 (GRanule Tip)

Aliases

PreTt22440 | 18.m00466 | 3701.m00223

Description

Localized to periphery of dense core granules, with distribution polarized toward the docking end

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 77.8%

TetraMine Data

TTHERM_00221120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06794.19.997093137033517e-262hypothetical protein (718 aa)
OxytrichaContig18293.0.g1060.0004000184047659232hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15752136: Bowman GR, Elde NC, Morgan G, Winey M, Turkewitz AP (2005) Core formation and the acquisition of fusion competence are linked during secretory granule maturation in Tetrahymena. Traffic (Copenhagen, Denmark) 6(4):303-23
  2. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7
  3. Ref:11779800: Bowman GR, Turkewitz AP (2001) Analysis of a mutant exhibiting conditional sorting to dense core secretory granules in Tetrahymena thermophila. Genetics 159(4):1605-16

Sequences

>TTHERM_00221120(coding)
ATGAGAAAATCTTGGATCATTATTGCAGCACTACTAGTTGTATCTGCAGTTGCTGATGTA
AAATTAGTAACTTCTGAATTCTCTGCTAAGAATTTCGATAGCTCAGCCGTATCTGGTTGG
TCAGTTACAGGAAACAAAAATAACAATTTAGTTTCTACTTGCGGTGATCAATCTATTTTT
GGTGGTTATGATGCTTTTGGTGCTCGTGCCAGCGCTAGCAAAGACTACAATTCTGGAGTC
GATCATTTTGAACTTACTTTCAATTTCGATATATACACTGTCGATTCTTGGGATAATGAA
GTCTTTTCTCTTTACGTCGATGACTAGTTAGTTTATAGTTTATAAGCTTAATTCAATACA
GTCTCTCCCAGACCAATTAATGGTGCTTGCGGTTCAGCATCATGGTAAGATAGATGGTAA
TCCGTCACTGTTAAGCTTAATCACTACAGAAGATAATTCAATGTTAGATTAACCTCTACT
CTTGATTAAGATGCTAATGATGAATCTTGGGGTGTCAAGAATTTCTAGATTCTCGCAAGA
CACGGTGGTGGTAACATTTAAGTAATTAGTGAAGAATTTAGCTAAGACTCATTTAAGAGC
GATGCTTCTTCATGGACTGTTGTCAACGTTTCACCAGCATTTACTACATGTGGTGATGGT
AACAAAATTTTCGGTGGTTTCAATTCTATGGGTAGGGATTCTATTGTTTCTAAAACCTAC
AATAATTTACCTTCTCATTATGGTGTTTTATTTGCCTTCGATCTCTGGCTTATTGATTCA
CCTGATGGCAATGATTACGTTTAAGTCATAGTTGATGGTTAAATATCTAGATTCTACAGA
CCTGATTGGAACTATGGTGACCCTTAAAATTTCTTATGCGGTGTTTAAGGATGGTCTGAA
AGAATTGTTAAAATTAACCTTTTCGTCCCTCACAAAGGTCCTTCAATTAATATTGCATTG
AGAGGTGTTTTTGATGAAGCAAAAGACAATGAATCCTTCGGTTTCAGAAACCTCAGAATT
GTTTCTCTTGGTTGCTCTTCAGCAAGATGCCAATAAGTTTCAAACGAATTCTATCAATAA
ACTTTTGCTGATCCTTAAGGCTGGACAGATGAAGGTGGAAATGCTCTCCCTTCTCCTTTC
AAAACTTGCTCTGGAGCTACATTATTTGGACCTTTCTCAGTTCCTATTGAAAAAACCTAT
GACTCACTCTAACCCCACTCTGGTGTAAGAGTCTTCTTAAGAGTCTTTGCTCTTGGAGAT
TGGTCAAACGCTAACACTAATTTGAGATTCTTCGTTAACGATGTCTTAACCACTCCTAAA
GTTGCTGCTGAATTCGCTAAGAATAAAATTTGTGATGCAGACACAGAAAGCGTTAGAAAC
TACTTCATTGATGTTCCTCATGCTAACTCTATCTTAGATCTCGATATTAAGCCCGTCAAC
TTTGCAGGAAACACTAAATATACTATCAGAGATTTATCCGTAACAGCTTACGTTGAAGAA
GGTCAAACTTTGATTTCATCAGAATTCACCTAAGTCAACTTCGATAGTGCCACTGGTTGG
ACTGTTAATGGAAACACAAATGGAGTAACTACATCAAGATGTGGTAGGTTCTCAGTCTTT
GGTGGATTTAATGCTTTTGGAAGAAAGACATCTGCCTCTAAGTTATATAACTCACTTCCT
GATCACGACTTCGCTGTCATCGTTTTCACCATTTACTTCATTGATACTTGGGATAGAGAA
AACTTTAACGTCGCTGTAGATGATGCCATCATAAAGAGAATGACTAAATCAGATACTTGG
TCTGGACATTAAAACTTGTGCGGTAGAGGTGATTCCATGGAAGAAACCTACACTGTCTAA
CTTTATGTACCTCATTCTGCTGCTACCCTTAAGCTTACTTTTAGTGATGAACTTGATCAA
ACAACCGTAAATAAGATATTCTTTATTAATTTATCATATAATTAAAAAATTTAAACTAAT
AATAGGATGATGAATCTTGGGGTATTAGAGATTTATCCGTTCTTGTTGGTAAGAACCAAG
GTGCTGGTTATGTTTCTAAAGACGATACTAACTGCATTTAAATTTTCACTGCTTGCAACT
ACGACGGCTAATCACTTTCTGTCTGCGATGATATCCCTGATTTATCTGCTATTGGATGGA
CTAAGCCAATCAGATCTATTAACATTCCTTAAGGAAAGAGTATTAAAGCCTACAAGTCTG
CTAATTACAAAGGAGATTTCAAGGAATTCACTTCTTCTCAAGATTGTTTAACTGGTCAAA
ACTATCTCCTTATTAACAGAGCTTTCAACATTGACGTTGAACCTGAAACAAAATTAAAAC
ACTAAAGAAGAGTTTGAAAAAACAAGCTTCTTTCAGATATTTTTAATATAAGTATGA


>TTHERM_00221120(protein)
MRKSWIIIAALLVVSAVADVKLVTSEFSAKNFDSSAVSGWSVTGNKNNNLVSTCGDQSIF
GGYDAFGARASASKDYNSGVDHFELTFNFDIYTVDSWDNEVFSLYVDDQLVYSLQAQFNT
VSPRPINGACGSASWQDRWQSVTVKLNHYRRQFNVRLTSTLDQDANDESWGVKNFQILAR
HGGGNIQVISEEFSQDSFKSDASSWTVVNVSPAFTTCGDGNKIFGGFNSMGRDSIVSKTY
NNLPSHYGVLFAFDLWLIDSPDGNDYVQVIVDGQISRFYRPDWNYGDPQNFLCGVQGWSE
RIVKINLFVPHKGPSINIALRGVFDEAKDNESFGFRNLRIVSLGCSSARCQQVSNEFYQQ
TFADPQGWTDEGGNALPSPFKTCSGATLFGPFSVPIEKTYDSLQPHSGVRVFLRVFALGD
WSNANTNLRFFVNDVLTTPKVAAEFAKNKICDADTESVRNYFIDVPHANSILDLDIKPVN
FAGNTKYTIRDLSVTAYVEEGQTLISSEFTQVNFDSATGWTVNGNTNGVTTSRCGRFSVF
GGFNAFGRKTSASKLYNSLPDHDFAVIVFTIYFIDTWDRENFNVAVDDAIIKRMTKSDTW
SGHQNLCGRGDSMEETYTVQLYVPHSAATLKLTFSDELDQTTVNKIFFINLSYNQKIQTN
NRMMNLGVLEIYPFLLVRTKVLVMFLKTILTAFKFSLLATTTANHFLSAMISLIYLLLDG
LSQSDLLTFLKERVLKPTSLLITKEISRNSLLLKIVQLVKTISLLTELSTLTLNLKQNQN
TKEEFEKTSFFQIFLIQV


>TTHERM_00221120(gene)
ATGAGAAAATCTTGGATCATTATTGCAGCACTACTAGTTGTATCTGCAGTTGCTGATGTA
AAATTAGTAACTTCTGAATTCTCTGCTAAGAATTTCGATAGCTCAGCCGTATCTGGTTGG
TCAGTTACAGGAAACAAAAATAACAATTTAGTTTCTACTTGCGGTGATCAATCTATTTTT
GGTGGTTATGATGCTTTTGGTGCTCGTGCCAGCGCTAGCAAAGACTACAATTCTGGAGTC
GATCATTTTGAACTTACTTTCAATTTCGATATATACACTGTCGATTCTTGGGGTAAATTC
ATCTTAATAATACAAAAAATATATTTTCAATTTTTTAAGTGCTTTTTAATACTTAATCAT
TAATGAGTTGCCATATTTGTGAATAATAAATAATTGCTAATGACGATTAAGCATAATATT
AACAAAAATTTTTAATTAATTAGATAATGAAGTCTTTTCTCTTTACGTCGATGACTAGTT
AGGTAATATATTTATTCATCAAACTCCAATTTTTAATATATTTTATACTTAAAAAATACA
GTTTATAGTTTATAAGCTTAATTCAATACAGTCTCTCCCAGACCAATTAATGGTGCTTGC
GGTTCAGCATCATGGTAAGATAGATGGTAATCCGTCACTGTTAAGCTTAATCACTACAGA
AGATAATTCAATGTTAGATTAACCTCTACTCTTGATTAAGATGCTAGTAAAATCAATTTT
TTAAAATTTATTGTTTCTATAATATTTTAATATTAATTTATCAGATGATGAATCTTGGGG
TGTCAAGAATTTCTAGATTCTCGCAAGACACGGTGGTGGTAACATTTAAGTAATTAGTGA
AGAATTTAGCTAAGACTCATTTAAGAGCGATGCTTCTTCATGGACTGTTGTCAACGTTTC
ACCAGCATTTACTACATGGTAATTATTATTTTTAAATTTTAATAAATTACTCCATCATAC
TAATATATTTATTGATTCATTCTTCATCAACGTATTGTTTAAATTGTTATATTTTATTTG
CAATAGTGGTGATGGTAACAAAATTTTCGGTGGTTTCAATTCTATGGGTAGGGATTCTAT
TGTTTCTAAAACCTACAATAATTTACCTTCTCATTATGGTGTTTTATTTGCCTTCGATCT
CTGGCTTATTGATTCACCTGATGGCAATGATTACGTTTAAGTCATAGTTGATGGTTAAAT
ATCTAGATTCTACAGACCTGATTGGAACTATGGTGACCCTTAAAATTTCTTATGCGGTGT
TTAAGGATGGTCTGAAAGAATTGTTAAAATTAACCTTTTCGTCCCTCACAAAGGTCCTTC
AATTAATATTGCATTGAGAGGTGTTTTTGATGAAGCAAAAGACAATGAATCCTTCGGTTT
CAGAAACCTCAGAATTGTTTCTCTTGGTTGCTCTTCAGCAAGATGCCAATAAGTTTCAAA
CGAATTCTATCAATAAACTTTTGCTGATCCTTAAGGCTGGACAGATGAAGGTGGAAATGC
TCTCCCTTCTCCTTTCAAAACTTGCTCTGGAGCTACATTATTTGGACCTTTCTCAGTTCC
TATTGAAAAAACCTATGACTCACTCTAACCCCACTCTGGTGTAAGAGTCTTCTTAAGAGT
CTTTGCTCTTGGAGATTGGTCAAACGCTAACACTAATTTGAGATTCTTCGTTAACGATGT
CTTAACCACTCCTAAAGTTGCTGCTGAATTCGCTAAGAATAAAATTTGTGATGCAGACAC
AGAAAGCGTTAGAAACTACTTCATTGATGTTCCTCATGCTAACTCTATCTTAGATCTCGA
TATTAAGCCCGTCAACTTTGCAGGAAACACTAAATATACTATCAGAGATTTATCCGTAAC
AGCTTACGTTGAAGAAGGTCAAACTTTGATTTCATCAGAATTCACCTAAGTCAACTTCGA
TAGTGCCACTGGTTGGACTGTTAATGGAAACACAAATGGAGTAACTACATCAAGATGTGG
TAGGTTCTCAGTCTTTGGTGGATTTAATGCTTTTGGAAGAAAGACATCTGCCTCTAAGTT
ATATAACTCACTTCCTGATCACGACTTCGCTGTCATCGTTTTCACCATTTACTTCATTGA
TACTTGGGATGTAAAAAATTATTTAATTTCCTAACTTCATCTTAATATTAAAAATAATTT
TATATATAAAGAGAGAAAACTTTAACGTCGCTGTAGATGATGCCATCATAAAGAGAATGA
CTAAATCAGATACTTGGTCTGGACATTAAAACTTGTGCGGTAGAGGTGATTCCATGGAAG
AAACCTACACTGTCTAACTTTATGTACCTCATTCTGCTGCTACCCTTAAGCTTACTTTTA
GTGATGAACTTGATCAAACAACCGTAAATAAGATATTCTTTATTAATTTATCATATAATT
AAAAAATTTAAACTAATAATAGGATGATGAATCTTGGGGTATTAGAGATTTATCCGTTCT
TGTTGGTAAGAACCAAGGTGCTGGTTATGTTTCTAAAGACGATACTAACTGCATTTAAAT
TTTCACTGCTTGCAACTACGACGGCTAATCACTTTCTGTCTGCGATGATATCCCTGATTT
ATCTGCTATTGGATGGACTAAGCCAATCAGATCTATTAACATTCCTTAAGGAAAGAGTAT
TAAAGCCTACAAGTCTGCTAATTACAAAGGAGATTTCAAGGAATTCACTTCTTCTCAAGA
TTGTTTAACTGGTCAAAACTATCTCCTTATTAACAGAGCTTTCAACATTGACGTTGAACC
TGAAACAAAATTAAAACACTAAAGAAGAGTTTGAAAAAACAAGCTTCTTTCAGATATTTT
TAATATAAGTATGA