Identifiers and Description

Gene Model Identifier

TTHERM_00106940

Standard Name

GRS1 (glycyl-tRNA synthetase 1)

Aliases

PreTt23088 | 7.m00537

Description

glycyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00106940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_92560
WormBaseWBGene000017449.997093137033517e-262locus:gars-1 status:Confirme
d UniProt:Q8I711 protein_i
d:CCD72866.1
Tetrahymena borealisEI9_00419.19.997093137033517e-262glycyl-tRNA synthetase (675 aa
)
DictyBaseDDB_G02845839.997093137033517e-262glyS on chromosome: 4 position
2181616 to 2183756
OxytrichaContig22561.0.g339.997093137033517e-262tRNA synthetase class II core
domain (G, H, P, S and T)
SGDYBR121C9.997093137033517e-262GRS1 Cytoplasmic and mitochond
rial glycyl-tRNA synthase that
ligates glycine to the cognat
e anticodon bearing tRNA; tran
scription termination factor t
hat may interact with the 3-en
d of pre-mRNA to promote 3-end
formation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00106940(coding)
ATGGATTTCAAAGATTTAAACGCTTAGGCTACCTTCACAAATAAGGAATTAGAAGAAAGA
AGAAAGTATTTCGAAGACTTGATTAAGAGAAGATACTTTTTTAACCAAGGTTTTGAAATT
TACGGTGGTGTTGCTGGTCTCTACGACTATGGTCCACCTGGTTGCGCCATCAAGAATAAC
TTGTTGAAGTTATGGAGAGAACACTTCATTTTGGAAGAAGATATGCTCGAAATATCATCA
ACTTGTATTACCCCTTATCCCGTTTTCAAGGCTTCTGGTCATGTTGATAGATTCACTGAT
TTGATGGTTAAGGATGTTAAGAATGGTGCTGGCCACAGAGCTGACAAATTGATTGAAGCT
TTCATTGAAGCTAAACTCTCCAAGAAGAAACTTAAACCTGAAGAAGTCAAGGAATTGGAA
GAAATTAAGCAAAAGGTTGAAACTTTTTCAGCTCAACAAATGCATGATGTCATCCAAAAG
TTAGGTATAAAATCTCCTGATACTGGTAATGAACTTGGTTTCCCTGAACCTTTCAATCTC
ATGTTTGGTACTCCTATTGGTCCTTCTGGTTAATTGCCAGGTTTTTTACGTCCTGAAACC
GCTTAAGGTATGTTCGTTAACTTCAATAGATTAAATGAATTCAACGGTGGTAGAATTCCT
TTCGCTGCTGCCCAAATCGGTTTGGGTTTCCGTAACGAAATCGCTCCTAGAAATGGTCTT
TACAGAGTTAGAGAATTCGATATGGCTGAAATTGAACATTTCTTTGATCCTAAGAGACCC
GAACATCCTAAGTTCAAGTATGTCAAGGATTTGAAGTTACCTCTTTTGACTGCTAAGAGC
TAAGAACACGGTGATGGTTCTGTTACTCAAATGACCTTAGAAGAAGCTGTTAAGTCTGGT
ACTGTTTCTAATGAAACACACGCTTATTTCATTGGAAGAACTTTCCTTTTCTTAGTCGAG
GCTGGTGTTAATCAAAATAATATTAGATTTAGACAACACATGTCTAATGAAATGGCTCAC
TACGCTTGTGACTGTTGGGATGCTGAAATCGAATTCTCTCACGGTTTCAAGGAATGTGTT
GGTTTGGCTAACAGATCTGCTTTCGATTTAGAAAGTCACACCAAGGGTTCTGGTGTCAAG
CTCTTAGCCGCCAGACGTTTACCTGAACCAAGAAAGGTTACCATTATTGATATTACTTTA
GACAAGAAGGAAATCTTCAAGGCTTTGAAGGGTGATGGTAATGAACTCACAAAACTTATT
GAAGGTTACAGTGATGAACAAAAGGCAGAACTCATGAAGAAGTTCGAAACTGCTGATTCA
GTTGAATTCGACATCAAGGTTAAAGAAGTTGAAAAGAAGGTTCAACTCCCCAAGGCTTTG
ATTTCATTCAAGGTTTCTGAATAAATGCAATAAGAAGAAAAGTTCGTTCCTTACGTCATC
GAACCTTCCTTCGGTGTTGGTCGTATCTTCTCTGCCATTTTGGAACATAGTTTCAGAATG
AGAGATGAAAAGAGAACTTTCTTCCACTTACCTCCTAAGATTTCCCCAATTAAATGCTCT
ATCCTCCCAGTTATTTCTCATGAAAAGTACAATGATGCCATTCACAAACTCAAGGTTGGA
TTGACTAAGGTTGGTGTTAGCTCTAAGGTTGACGATACTGGTCATGCCATTGGTAGAAGA
TATGCAAGAACCGACGAATTAGGTATTCCCTTCGGTATTACTATTGATAATGATACTCTT
GTTGATGATTCAGTTACTCTCAGAGAAATTCTTACCACTAAATAAATCAGAATTCCCATT
AACGATGTATTCAGAGTTGTCAGTGATTTGGCTGATGGTCTCATTACTTGGGATAGCGTC
TTAGCCAAATACCCCTTATTCAAGCCTAATGCTTCTGAAGAAAATTGA


>TTHERM_00106940(protein)
MDFKDLNAQATFTNKELEERRKYFEDLIKRRYFFNQGFEIYGGVAGLYDYGPPGCAIKNN
LLKLWREHFILEEDMLEISSTCITPYPVFKASGHVDRFTDLMVKDVKNGAGHRADKLIEA
FIEAKLSKKKLKPEEVKELEEIKQKVETFSAQQMHDVIQKLGIKSPDTGNELGFPEPFNL
MFGTPIGPSGQLPGFLRPETAQGMFVNFNRLNEFNGGRIPFAAAQIGLGFRNEIAPRNGL
YRVREFDMAEIEHFFDPKRPEHPKFKYVKDLKLPLLTAKSQEHGDGSVTQMTLEEAVKSG
TVSNETHAYFIGRTFLFLVEAGVNQNNIRFRQHMSNEMAHYACDCWDAEIEFSHGFKECV
GLANRSAFDLESHTKGSGVKLLAARRLPEPRKVTIIDITLDKKEIFKALKGDGNELTKLI
EGYSDEQKAELMKKFETADSVEFDIKVKEVEKKVQLPKALISFKVSEQMQQEEKFVPYVI
EPSFGVGRIFSAILEHSFRMRDEKRTFFHLPPKISPIKCSILPVISHEKYNDAIHKLKVG
LTKVGVSSKVDDTGHAIGRRYARTDELGIPFGITIDNDTLVDDSVTLREILTTKQIRIPI
NDVFRVVSDLADGLITWDSVLAKYPLFKPNASEEN


>TTHERM_00106940(gene)
ATGGATTTCAAAGATTTAAACGCTTAGGCTACCTTCACAAATAAGGTGAGACCATTTTTT
TCAAATATCTTTAAATAGTAAATGCCTCCTGAAATTTTTTAGCAACTTGAATTAGCATTT
AAGTCTTTATCAGGCAAAGAGAGGCAGGCTGTGATTTTTAATTATATCGCAGATTTAGAT
TAGTTTAATTGATGCGTACAATTATTGCTTACTAATATTGCTTTTTTAACTAAAATTATA
GGAATTAGAAGAAAGAAGAAAGTATTTCGAAGACTTGATTAAGAGAAGATACTTTTTTAA
CCAAGGTTTTGAAATTTACGGTGGTGTTGCTGGTCTCTACGACTATGGTCCACCTGGTAA
TTAAAATTAATAATTTTCAAAATTATTTGCTTCTAGTATAAAAGCCTTTAAGGTGTTTAG
GAAGAAGAATTTAAACATAGTAAATAACAAACATGTAACTAAATAAAGTTCAACAATAAA
ATCTAAGAAATAGATTATTTTAAGATAGATGAATTAGATAATATTTCATACTTAAATTTT
CACTTATTGAACAAAAAATCAAAAATGAATAAGCAAAATAAATAGGAAATAAAAAATCAA
AGATATTCATAACACAAACTAGATTAAGGCCTTAAATTACTTCTAAAATTATTTTAAAAC
AAAAGAAGAGCCATTTTATTTTTATTTCAGCTTAAATAGATGATTACATACAAATAATAA
CATATTTTTTTTTATTTATTTATAAGGTTGCGCCATCAAGAATAACTTGTTGAAGTTATG
GAGAGAACACTTCATTTTGGAAGAAGATATGCTCGAAATATCATCAACTTGTATTACCCC
TTATCCCGTTTTCAAGGCTTCTGTAAAAAATTTATAAATATCAAGATTTTTTTAAAAGAA
TTTGACATTAAACAAGCAAAAATATATCATTATCGAAACTAAGTAAGTAGATTTAGATAT
TAATCAAAATCCTCTAAATAGAACTAAAACTCAATAAATAGATTTCTAAAATTTAACAAA
AGAGAAAATTCGCTTTAGATATTTTTATTTAAATTACAGCATCAAAAATAAATAAATAAA
CTTTAAAGATATCCTCAAGCAAGCAAGATATTAATCAGATTTAGAATCAAAGTTTTGTTT
AATAAGCATTTTTTACTAATTAAATAAATTGATGCAACACATAATTAAAATAAACATTTA
AAAATTATTTTTATAAAACTTTTAATAAATTATTTTCGTTAATAAAAATCTATTTTAATA
ACTTATATGAAAAATACTTTAAAAACTATTCATTGGATCATTTTCATTGTTCTAAGTTGA
TAATTTAATAATAAAGGGTCATGTTGATAGATTCACTGATTTGATGGTTAAGGATGTTAA
GAATGGTGCTGGCCACAGAGCTGACAAATTGATTGAAGCTTTCATTGAAGCTAAACTCTC
CAAGAAGAAACTTAAACCTGAAGAAGTCAAGGAATTGGAAGAAATTAAGCAAAAGGTTGA
AACTTTTTCAGCTCAACAAATGCATGATGTCATCCAAAAGTTAGGTATAAAATCTCCTGA
TACTGGTAATGAACTTGGTTTCCCTGAACCTTTCAATCTCATGTTTGGTACTCCTATTGG
TCCTTCTGGTTAATTGCCAGGTTTTTTACGTCCTGAAACCGCTTAAGGTATGTTCGTTAA
CTTCAATAGATTAAATGAATTCAACGGTGGTAGAATTCCTTTCGCTGCTGCCCAAATCGG
TTTGGGTTTCCGTAACGAAATCGCTCCTAGAAATGGTCTTTACAGAGTTAGAGAATTCGA
TATGGCTGAAATTGAACATTTCTTTGATCCTAAGAGACCCGAACATCCTAAGTTCAAGTA
TGTCAAGGATTTGAAGTTACCTCTTTTGACTGCTAAGAGCTAAGAACACGGTGATGGTTC
TGTTACTCAAATGACCTTAGAAGAAGCTGTTAAGTCTGGTACTGTTTCTAATGAAACACA
CGCTTATTTCATTGGAAGAACTTTCCTTTTCTTAGTCGAGGCTGGTGTTAATCAAAATAA
TATTAGATTTAGACAACACATGTCTAATGAAATGGCTCACTACGCTTGTGACTGTTGGGA
TGCTGAAATCGAATTCTCTCACGGTTTCAAGGAATGTGTTGGTTTGGCTAACAGATCTGC
TTTCGATTTAGAAAGTCACACCAAGGGTTCTGGTGTCAAGCTCTTAGCCGCCAGACGTTT
ACCTGAACCAAGAAAGGTTACCATTATTGATATTACTTTAGACAAGAAGGAAATCTTCAA
GGCTTTGAAGGGTGATGGTAATGAACTCACAAAACTTATTGAAGGTTACAGTGATGAACA
AAAGGCAGAACTCATGAAGAAGTTCGAAACTGCTGATTCAGTTGAATTCGACATCAAGGT
TAAAGAAGTTGAAAAGAAGGTTCAACTCCCCAAGGCTTTGATTTCATTCAAGGTTTCTGA
ATAAATGCAATAAGAAGAAAAGTTCGTTCCTTACGTCATCGAACCTTCCTTCGGTGTTGG
TCGTATCTTCTCTGCCATTTTGGAACATAGTTTCAGAATGAGAGATGAAAAGAGAACTTT
CTTCCACTTACCTCCTAAGATTTCCCCAATTAAATGCTCTATCCTCCCAGTTATTTCTCA
TGAAAAGTACAATGATGCCATTCACAAACTCAGTAAGATTTTGTTTTATAGATTTATTAA
TTTAAATAAAAATTGTTTAATTTGATTAAATTTATAAATTATATAAATTAATTTATTAAA
ATGAATTATTTTATAGAGGTTGGATTGACTAAGGTTGGTGTTAGCTCTAAGGTTGACGAT
ACTGGTCATGCCATTGGTAGAAGATATGCAAGAACCGACGAATTAGGTATTCCCTTCGGT
ATTACTATTGATAATGATACTCTTGTTGATGATTCAGTTACTCTCAGAGAAATTCTTACC
ACTAAATAAATCAGAATTCCCGTAAAAATTAAAATAATAATAATAAAGTTTTTCTTATTA
AAAATTTTAAATAAAAGATTAACGATGTATTCAGAGTTGTCAGTGATTTGGCTGATGGTC
TCATTACTTGGGATAGCGTCTTAGCCAAATACCCCTTATTCAAGCCTAATGCTTCTGAAG
AAAATTGA