Identifiers and Description

Gene Model Identifier

TTHERM_01018540

Standard Name

GRL9 (GRanule Lattice)

Aliases

PreTt27771 | 199.m00064

Description

Granule lattice protein; acidic protein of dense core granules; contains coiled-coil region

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF00627 ) UBA/TS-N domain
  • ( PF04012 ) PspA/IM30 family
  • ( PF09325 ) Vps5 C terminal like
  • ( TIGR03042 ) photosystem II protein PsbQ
  • ( PF06295 ) conserved hypothetical protein
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( PF05289 ) Borrelia hemolysin accessory protein
  • ( PF07554 ) Uncharacterised Sugar-binding Domain
  • ( PF08680 ) Protein of unknown function (DUF1779)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01018540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00086.19.997639769646959e-151granule lattice protein 5 (376
aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60

Sequences

>TTHERM_01018540(coding)
ATGAGAGTTATTGCTGCCCTCCTCGTTATTGCACTTGTCTGCCAAAGTGCTATGGCTGTT
ACTTCCAAGTCCCAAGTCAAGTTGATGATGGAAAAGATCAACTCTAAGATGGAGAAATCC
CCCCTTGGTCGTGCCTTAAAGGGTATGGTCACCATTGCCACCAAGCTCGGTTATGACTAC
TAAGATCTCTATGATGCCTTCGCTGCCCTCAAGAATTAATTATTAAACAGCCTTGATAAC
GAAAATTCCTTATTCGAAGAATAAACCGCTTGTCATGAGAATTTTATTGCTCAATTCAAC
GCTTTAATCAGCAACTACACTAGTCAAATTAATGATACTGAAGCTTAATTAAACTACCTC
AACGACTCCTTGAACACCTATGAACAAAACTTAAAGGATGCTCAACAAGCTCTCTAAGAC
AACACTGATGCTCTCAATGCTGCCGAAGAAGCTCTTGCCCAAGCTGAAGTTCTTTACCAT
TATGCCACCGCTGAATACAGCAATGCTGACTAAGTTATCGGAGTCGCTATTGAAAAACTC
CAAGAAGCTTAATCTCACTACGACAATGCTGACCTCGGATCTTTCTCCTTCGTTTAAATC
AAGAACACCTTCGTTTCTTTCGCTTAAAAGATTACTGAAGCCACCAAGGGAATGAATGCC
AAGCACTAACTCTTCGTCAAACCTGTTGTCTAAGCTATGATGTAAGTTAAGAACAACACC
AGTTAAACCTCAATCTAAACTGCTATCAAGGCCCTCTAAGACTTACAAGCTTACTTCCAA
AAGACCTTCACTGATCTTACCAACGAATACGTTATCTTCACCTAAAATGTCTAATCCACC
ATTGATGGTCTCAACTAACTTATAGATATCTTATAAAACTAAACCATCCCTGGATATGAA
AGTCAAATCAGCTAAATACAAGCTTAAATCTAATAATTTGAAGATGCTCTCTCTCTTGCC
TAACAAAACTTAAAATAAGCTTAAGACTATATTTCTGCTGAATATGAAATATTTGCAATA
GTTCAAGCTAGACACTAAGCTCTCGTTGACAGAATCAACTCCGAATATGACCTCGTTACC
CAAGCTGACAGAATCGTTAGAAACGCTCAAGCTTAAGTTAACTACTCTAACTGA


>TTHERM_01018540(protein)
MRVIAALLVIALVCQSAMAVTSKSQVKLMMEKINSKMEKSPLGRALKGMVTIATKLGYDY
QDLYDAFAALKNQLLNSLDNENSLFEEQTACHENFIAQFNALISNYTSQINDTEAQLNYL
NDSLNTYEQNLKDAQQALQDNTDALNAAEEALAQAEVLYHYATAEYSNADQVIGVAIEKL
QEAQSHYDNADLGSFSFVQIKNTFVSFAQKITEATKGMNAKHQLFVKPVVQAMMQVKNNT
SQTSIQTAIKALQDLQAYFQKTFTDLTNEYVIFTQNVQSTIDGLNQLIDILQNQTIPGYE
SQISQIQAQIQQFEDALSLAQQNLKQAQDYISAEYEIFAIVQARHQALVDRINSEYDLVT
QADRIVRNAQAQVNYSN


>TTHERM_01018540(gene)
ATGAGAGTTATTGCTGCCCTCCTCGTTATTGCACTTGTCTGCCAAAGTGCTATGGCTGTT
ACTTCCAAGTCCCAAGTCAAGTTGATGATGGAAAAGATCAACTCTAAGATGGAGAAATCC
CCCCTTGGTCGTGCCTTAAAGGGTATGGTCACCATTGCCACCAAGCTCGGTTATGACTAC
TAAGATCTCTATGATGCCTTCGCTGCCCTCAAGAATTAATTATTAAACAGCCTTGATAAC
GAAAATTCCTTATTCGAAGAATAAACCGCTTGTCATGAGAATTTTATTGCTCAATTCAAC
GCTTTAATCAGCAACTACACTAGTCAAGTAATAAAAAATACAATTTTAAAAGAAATATAA
TTTGTGAATAGTTAAATTCTCATCCAAAAAAATAAAATAAAATGAATAATATTTATAAAC
TAATAAGTTGTTTCTAACTTCACCAACTAATCAAGCAGTTGATTTATTCATTGATTGATT
ATAATATTTTAAATTTTATAAACAGATTAATGATACTGAAGCTTAATTAAACTACCTCAA
CGACTCCTTGAACACCTATGAACAAAACTTAAAGGATGCTCAACAAGCTCTCTAAGACAA
CACTGATGCTCTCAATGCTGCCGAAGAAGCTCTTGCCCAAGCTGAAGTTCTTTACCATTA
TGCCACCGCTGAATACAGCAATGCTGACTAAGTTATCGGAGTCGCTATTGAAAAACTCCA
AGAAGCTTAATCGTAAATAAAGAATTATCTATTTATTCATTTTGATTTTTTATCAATTAA
ATGAAATGTTATATCAAGCCTTTTGCAATGCATTAATAATTGATTTATTATAAATAATTA
TAGTCACTACGACAATGCTGACCTCGGATCTTTCTCCTTCGTTTAAATCAAGAACACCTT
CGTTTCTTTCGCTTAAAAGATTACTGAAGCCACCAAGGGAATGAATGCCAAGCACTAACT
CTTCGTCAAACCTGTTGTCTAAGCTATGATGTAAGTTAAGAACAACACCAGTTAAACCTC
AATCTAAACTGCTATCAAGGCCCTCTAAGACTTACAAGCTTACTTCCAAAAGACCTTCAC
TGATCTTACCAACGAATACGTTATCTTCACCTAAAATGTCTAATCCACCATTGATGGTCT
CAACTAACTTATAGATATCTTATAAAACTAAACCATCCCTGGATATGAAAGTCAAATCAG
CTAAATACAAGCTTAAATCTAATAATTTGAAGATGCTCTCTCTCTTGCCTAACAAAACTT
AAAATAAGCTTAAGACTATATTTCTGCTGAATATGAAATATTTGCAATAGTTCAAGCTAG
ACACTAAGCTCTCGTTGACAGAATCAACTCCGAATATGACCTCGTTACCCAAGCTGACAG
AATCGTTAGAAACGCTCAAGCTTAAGTTAACTACTCTAACTGA