Identifiers and Description

Gene Model Identifier

TTHERM_01055600

Standard Name

GRL8 (GRanule Lattice)

Aliases

PreTt15314 | 215.m00057 | NDC1 | 3809.m00228

Description

Granule lattice protein; essential for normal DCG biosynthesis; mutants are exocytosis deficient and closely resemble GRL1 mutants; contains signal peptide; putative protein is acidic and is predicted to form coiled coils

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01055600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20627.19.997093137033517e-262hypothetical protein (400 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60
  2. Ref:11438705: Chilcoat ND, Elde NC, Turkewitz AP (2001) An antisense approach to phenotype-based gene cloning in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 98(15):8709-13

Sequences

>TTHERM_01055600(coding)
ATGAACAAGGCCTTAGTTTTCTTAGCTATTATTGCTCTCGGCTTCGCCGCCTCAACCCAA
TAAGTCAGCGCTCTTGACCCCAGTGAAAATGCTGCTGATGCTTTGATTGACCAACTCAAC
CAAATGGAAGGAGCTATCAGAAAGGAATAATAAGCTCACGACGAATTAGCCCAAGAATAA
GATGCTGAATGCGCCCAAGAATTCTAATTCAGACAAAACGAAATCAACGATGCCCAAAAT
GCTTTTGACGCTGCTAACGCTGCTGCCGGAAGATGCCAAAATGCTTTGACTGCTTCCCAA
GCTGATTTGGAAAAGGCTAACAACTACGTCTCCAGCATCTAATAAATCCTTGCTGGTTTG
GCTTCTTAAAGACTTGCTGAACACAATGCTTACGAAGATTTGGTCAACAACCAACTCCAA
CCTGCCATCGATGCCGTCCAAGGTGCTTACCCCATCTTGAGTGACTTCGCTTCCCAAACT
GTTTCCTTCGTCTAATTCTCCAACCACATCAACAAGATGTTCCTCTAGATGGTCAAGGCT
AACAAGGTTAACTCCTTCACTGCTATCCTCACCGTCTTACTCTCTCAACCTGACTTCTAA
CACGGAGTTGGCCGTGATGCTATTGATCAACTTTAGGCTTTATTCGAATAATTAGAATAA
GACCTCTAAGCTGCTCTTGACCACGCCACCGAAGTTGAAAACAACGCTGTCTAAGTTTAC
AACGACACCGTCAATGAATACAACGCTGTCTTGGCCACCCTCGATGCCACCATCAGCTCT
TTGAACGACTACATTTCCAGCTTAGAAAACTGCGTCTAAAACGAAAACAGTATTGCCAGC
CAAGCCAATGCTAAGAAGGTTAGAAACTCTGATGCCCTCGCTTACGCTGTTGATATGTGC
CAAGCTTTCGACACTGAATACTAAAACGCCACTGCCGCCAGAAACGACGAATTGGCTTTA
CTCCAAAAGTTAGAAAACTTCGTCCACGAATAAGCTGATATCTTCGGTGACTACGGTACT
GATAATGTTGATGCTTTCGATGACTTCAAGCAATCTTACGATGCCCAAAGAGACACTCAA
AGAGGTAACTTCATGCAAATGAAGATCAAGCAATTCAAGATGAACAGCAACTTCAAGAAG
GTCGCTAAGTGTGAAAGCTGTTCAAGAAAATCCTTCGTTCAAAAGAAGCTCGGTTTCTGA


>TTHERM_01055600(protein)
MNKALVFLAIIALGFAASTQQVSALDPSENAADALIDQLNQMEGAIRKEQQAHDELAQEQ
DAECAQEFQFRQNEINDAQNAFDAANAAAGRCQNALTASQADLEKANNYVSSIQQILAGL
ASQRLAEHNAYEDLVNNQLQPAIDAVQGAYPILSDFASQTVSFVQFSNHINKMFLQMVKA
NKVNSFTAILTVLLSQPDFQHGVGRDAIDQLQALFEQLEQDLQAALDHATEVENNAVQVY
NDTVNEYNAVLATLDATISSLNDYISSLENCVQNENSIASQANAKKVRNSDALAYAVDMC
QAFDTEYQNATAARNDELALLQKLENFVHEQADIFGDYGTDNVDAFDDFKQSYDAQRDTQ
RGNFMQMKIKQFKMNSNFKKVAKCESCSRKSFVQKKLGF


>TTHERM_01055600(gene)
ATGAACAAGGCCTTAGTTTTCTTAGCTATTATTGCTCTCGGCTTCGCCGCCTCAACCCAA
TAAGTCAGCGCTCTTGACCCCAGTGAAAATGCTGCTGATGCTTTGATTGACCAACTCAAC
CAAATGGAAGGAGCTATCAGAAAGGAATAATAAGCTCACGACGAATTAGCCCAAGAATAA
GATGCTGAATGCGCCCAAGAATTCTAATTCAGACAAAACGAAATCAACGATGCCCAAAAT
GCTTTTGACGCTGCTAACGCTGCTGCCGGAAGATGCCAAAATGCTTTGACTGCTTCCCAA
GCTGATTTGGAAAAGGCTAACAACTACGTCTCCAGCATCTAATAAATCCTTGCTGGTTTG
GCTTCTTAAAGACTTGCTGAACACAATGCTTACGAAGATTTGGTCAACAACCAACTCCAA
CCTGCCATCGATGCCGTCCAAGGTGCTTACCCCATCTTGAGTGACTTCGCTTCCCAAACT
GTTTCCTTCGTCTAATTCTCCAACCACATCAACAAGATGTTCCTCTAGATGGTCAAGGCT
AACAAGGTTAACTCCTTCACTGCTATCCTCACCGTCTTACTCTCTCAACCTGACTTCTAA
CACGGAGTTGGCCGTAATAATTACATTTTTTTTACATTTATCCAAGCCATAAATGGCAGA
TTAAATTAATCTTACATTCAACTACAAATAGCAAATAAATTAATAATATTCCATTTGATT
TGAATAATTTACTTCTTTTAAAAATTAATGGCTTCAAACATGAAAATTAATTAATTATTT
ATTCAATAATATAGGTGATGCTATTGATCAACTTTAGGCTTTATTCGAATAATTAGAATA
AGACCTCTAAGCTGCTCTTGACCACGCCACCGAAGTTGAAAACAACGCTGTCTAAGTTTA
CAACGACACCGTCAATGAATACAACGCTGTCTTGGCCACCCTCGATGCCACCATCAGCTC
TTTGAACGACTACATTTCCAGCTTAGAAAACTGCGTCTAAAACGAAAACAGTATTGCCAG
CCAAGCCAATGCTAAGAAGGTTAGAAACTCTGATGCCCTCGCTTACGCTGTTGATATGTG
CCAAGCTTTCGACACTGAATACTAAAACGCCACTGCCGCCAGGTAATAAATATTTAAATG
ATTTTCAAGTAAACATATGTTAACGTTTTATTACTTAAAATAGAAACGACGAATTGGCTT
TACTCCAAAAGTTAGAAAACTTCGTCCACGAATAAGCTGATATCTTCGGTGACTACGGTA
CTGATAATGTTGATGCTTTCGATGACTTCAAGCAATCTTACGATGCCCAAAGAGACACTC
AAAGAGGTAACTTCATGCAAATGAAGATCAAGCAATTCAAGATGAACAGCAACTTCAAGA
AGGTCGCTAAGTGTGAAAGCTGTTCAAGAAAATCCTTCGTTCAAAAGAAGCTCGGTTTCT
GA