Identifiers and Description

Gene Model Identifier

TTHERM_00522600

Standard Name

GRL7 (GRanule Lattice)

Aliases

PreTt12375 | 65.m00193 | 3717.m00072

Description

Granule lattice protein; acidic, calcium-binding structural protein of dense core granules; translated as a pro-protein precursor; contains coiled-coil region; also identified as mating-related initiation and co-stimulation factor-A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF03148 ) Tektin family
  • ( PF01920 ) Prefoldin subunit
  • ( PF08227 ) DASH complex subunit Hsk3 like
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF07197 ) Protein of unknown function (DUF1409)
  • ( TIGR00178 ) isocitrate dehydrogenase, NADP-dependent

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00522600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12846.19.997093137033517e-262hypothetical protein (378 aa)
OxytrichaContig11784.0.g110.0005997485943342685Reovirus sigma C capsid protei
n

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60
  2. Ref:14690495: Turkewitz AP (2004) Out with a bang! Tetrahymena as a model system to study secretory granule biogenesis. Traffic (Copenhagen, Denmark) 5(2):63-8
  3. Ref:9450970: Verbsky JW, Turkewitz AP (1998) Proteolytic processing and Ca2+-binding activity of dense-core vesicle polypeptides in Tetrahymena. Molecular biology of the cell 9(2):497-511

Sequences

>TTHERM_00522600(coding)
ATGAGAAAAGTCTTCGTTGCTTTGGCTTTAGTTGCCATCATCGTCAGTGCTACCATGCTC
CCTGAAGTTAGACAAAGAGCTAAAGTCAGCTTACAAAAGCTTCACAAGAGCAGAATTGGT
AAGAACATCGTTACTGCCATCTAACTCGAATTGAGCTCAAAGAACCGTGATAACATTATT
GTTAACATCCTTGCTCTCCTTAATGATTTATTGAACGATTAATCCACTTAATTAACCAAA
GCTCAATCTGACTTAGCTGATAAGTAAGACTATTGTGGATCTAGCATTGAATCTTATCAA
AACTAAATCGCCTCCAAGCAAGCTGATATTGCTAACGCTTAAGCTTCCCTCCCTGCTCTC
CACGCTGAATTAGAAACTGACTAAGCTAACTTAGCTGACTAAGAAGCCAAATTAGACAGA
GCTCAACAAAATTTAGCTGAAGCTAATGACCTCAACGATGCTGCTGTTGCTGCCTTCAAC
ACCTCCATTGCTAACCACAATGCTATGATTGATGCCCTTAAATAAGCTAGAGCTCTCATC
GTCCAACTCTAATCTTCTTCTTTCCTTTAAAAGAACAACGCCGTCCTCATCCAACTCTCC
AACCACAAGGCTTTGGCTTTGAAGAAGCTCGAAGGACACGCCAAGAAATCTCTCTTCTCC
CTCTTAATGCAAATGGCTCAAGATGTTGGTATCCAAGCTGACTAAACCCTCGTCGGAAAC
GTTCTTACTGTTATTGACGATTTACTCCAACACGAATAAGACGGTATTGATGCTGAAACC
TAAGCTGAAAACTAAAGAGTTGAAGAATACAACGCTGCAGTCATTGACTTCAACAATTAA
ATCAGTGATGCTCAAGGTTAAATCGCCTCCTTAAATTAAGATATCTAAACTCTTACCAAC
AATATTAATGACACCGAAAATAACATCGCCACCTGGTCCTAATAAGTTTCTGACTTACAA
GGTGTCCTCGACGAACTCCAAAACTAATGCAATGCTGATATTGCTCACTTCTAAGATTTA
ATCTAAGAATTAAACGGAATTATTGATATCATCCAACAAGTTATCGCTATCTTCGAAGGT
CAATCCATCTAAGACGTCAAGCCCCTTTTCGATGACATTAGCGTAGATGACGGTCTCGGA
AGTGCTGAAAGCGCTTGA


>TTHERM_00522600(protein)
MRKVFVALALVAIIVSATMLPEVRQRAKVSLQKLHKSRIGKNIVTAIQLELSSKNRDNII
VNILALLNDLLNDQSTQLTKAQSDLADKQDYCGSSIESYQNQIASKQADIANAQASLPAL
HAELETDQANLADQEAKLDRAQQNLAEANDLNDAAVAAFNTSIANHNAMIDALKQARALI
VQLQSSSFLQKNNAVLIQLSNHKALALKKLEGHAKKSLFSLLMQMAQDVGIQADQTLVGN
VLTVIDDLLQHEQDGIDAETQAENQRVEEYNAAVIDFNNQISDAQGQIASLNQDIQTLTN
NINDTENNIATWSQQVSDLQGVLDELQNQCNADIAHFQDLIQELNGIIDIIQQVIAIFEG
QSIQDVKPLFDDISVDDGLGSAESA


>TTHERM_00522600(gene)
ATGAGAAAAGTCTTCGTTGCTTTGGCTTTAGTTGCCATCATCGTCAGTGCTACCATGCTC
CCTGAAGTTAGACAAAGAGCTAAAGTCAGCTTACAAAAGGTACCTTAAAGCATTTCAACA
CTTATCTCCATTAAATTAGAGCTAATAAGAATGTCTTCTTCAAGCTTTTATGCGGCAGCA
ATCAATCAATACTTTAGAGCTATCTTATTAAAAGAAAACAAAGAGTTAAAGAGTGAGTCG
TAGGGCATGAGGAATTAAGTTAATAGAACGAAGCTAATCAAACTTCTTAAAGAAATAGTC
ATTATAGACTTTTCTTGAGAAGTTAATCTTTTAGCACCCTTAAGTAGCTATGCCATTTTC
CTTTGTTTAAATCATTCTAAAAATTTTTAAAGAATGGTAAACATAAAGATAGGCTTCTTA
AATTCGATAGATTTAATAAATTAACTATTTCCTTCAAGCTCTTTTTACCTAATTGTTAGG
TGACTCTTAATTCTTCAAGAAAAAAGCATAACTCAAATATATAGTATATCTAAAAAAACA
AACAATCAAACAACGACAAATAGTCGATAAAAAAATCAACAACTGCTGCCGCTATTTTAA
CTCTCAAAAATTTCAAATGAAAATCAATCAAGATTATACATACACCAAATAAATAAAGAA
ACCACAAAACATACATTATTTATTGATTTAGCACATTCTTTAATTTTTGCATTTATTTCT
TCTCTTGAGAGTTTTACAAATAAAAAAGACAAGAAAGAAGTGTCAATTTATTTGGCATTT
AAAAAACGTTTTTCAATATTAAAACACCAATTTATTTTTTTAAAGTATTTAATTTATTTT
ACAATTAATTTTATAGCTTCACAAGAGCAGAATTGGTAAGAACATCGTTACTGCCATCTA
ACTCGAATTGAGCTCAAAGAACCGTGATAACATTATTGTTAACATCCTTGCTCTCCTTAA
TGATTTATTGAACGATTAATCCACTTAATTAACCAAAGCTCAATCTGACTTAGCTGATAA
GTAAGACTATTGTGGATCTAGCATTGAATCTTATCAAAACTAAATCGCCTCCAAGCAAGC
TGATATTGCTAACGCTTAAGCTTCCCTCCCTGCTCTCCACGCTGAATTAGAAACTGACTA
AGCTAACTTAGCTGACTAAGAAGCCAAATTAGACAGAGCTCAACAAAATTTAGCTGAAGC
TAATGACCTCAACGATGCTGCTGTTGCTGCCTTCAACACCTCCATTGCTAACCACAATGC
TATGATTGATGCCCTTAAATAAGCTAGAGCTCTCATCGTCCAACTCTAATCTTCTTCTTT
CCTTTAAAAGAACAACGCCGTCCTCATCCAACTCTCCAACCACAAGGCTTTGGCTTTGAA
GAAGCTCGAAGGACACGCCAAGAAATCTCTCTTCTCCCTCTTAATGCAAATGGCTCAAGA
TGTTGGTATCCAAGCTGACTAAACCCTCGTAATTTTTTATTTACTAATAAAATCTATCTA
ACTATCAATCAATCCTATTTTTATTTCATATAATTAATTAATAATATTTTGAAAAAATTA
GGTCGGAAACGTTCTTACTGTTATTGACGATTTACTCCAACACGAATAAGACGGTATTGA
TGCTGAAACCTAAGCTGAAAACTAAAGAGTTGAAGAATACAACGCTGCAGTCATTGACTT
CAACAATTAAATCAGTGATGCTCAAGGTTAAATCGCCTCCTTAAATTAAGATATCTAAAC
TCTTACCAACAATATTAATGACACCGAAAATAACATCGCCACCTGGTCCTAATAAGTTTC
TGACTTACAAGGTGTCCTCGACGAACTCCAAAACTAATGCAATGCTGATATTGCTCACTT
CTAAGATTTAATCTAAGAATTGTAAGATTTTTTTCAAATTAGAAAATTATGAAAAAATAT
TTTTTAATTATAACCTCTTTTTAAACTTATACTGAATTTATTTAATAATAATTTAGAAAC
GGAATTATTGATATCATCCAACAAGTTATCGCTATCTTCGAAGGTCAATCCATCTAAGAC
GTCAAGCCCCTTTTCGATGACATTAGCGTAGATGACGGTCTCGGAAGTGCTGAAAGCGCT
TGA