Identifiers and Description

Gene Model Identifier

TTHERM_00321730

Standard Name

GRL6 (GRanule Lattice )

Aliases

PreTt15991 | 32.m00235

Description

Granule lattice protein; transcripts present at low levels; not essential for core assembly; knockout cells show change in granule morphology and reduction in granule accumulation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF02370 ) M protein repeat
  • ( PF07106 ) Tat binding protein 1(TBP-1)-interacting protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00321730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10071.10.000000000029994712494008525hypothetical protein (465 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60

Sequences

>TTHERM_00321730(coding)
ATGGAACAAATAAGTCTACAAATACAAAATAGCTTAGAGGAAGCAATCAGCATTTTAAAA
ATAATTTCAAACTCATAGGAAAAGGGATTAATATTAACTGATATTTTAATCAACGACATT
TACTTCATAAGAAATTTGATTCTTTCTGGAAAAGAAGAACAACTAAATAATTATTTTTAA
GATTTAAACATAATTGTAGACAAAGCTAAATTAATCAAGAACAATCTTACATTTAGCTGT
GTTAGTAAGTATGGAAATTTTATATAAATTTTTCAATAAGAACCCATAAAAGTGATATTC
TAAAAAATCAACAGCATCCTTCAAAATATCAAAAAATAATTTCCAAAGTAAATAGATTCT
AATGATGTTTATAGCTTAGACTCTAAAAAAATAGAATAAATTTTTAAATTGCATAGTAAA
TTATAAACATTTAGACAATATTAAAACATGAATTAATTCTAATCTTATCACTAACTCACT
GTTCTCTTTAAAATGTGTAATGACTAATAAGGAGAGAGAGAAAGTCTATTAAAATCTATT
GCCTCATTCATATTACCCACTAGTGAAGGATAATAGGTAGATTACAATAGCATTTTTAAA
ATATTAGGAATTGAAAATAATAATCAGCCAATAAGTGAAAAGTCTCTTTAGTTGTTAAAT
ATTTTTTTTTAAGATTGCTGGCTAAACAGGAAATATCTATTAAGATTATTTTAACAAGGT
TGTCTGACGAGTTAAAATAAATAAATTGCTATTGAGTAATATATTCCATTAAAAGACTTA
AAACTTAAAATATGCAATGGAGACTTTGAAGGAGTGATTCAAAGTTCTCAGTCCTTGCTT
TTAGAAAAAAATAAATTATAAATCATAGGAGAAAGAAAAGTAAGTGAAATGAATTACTAA
CATAGTGTTAATTAAATATGTAAGTATAAATTATTTACTTTAGAACCTTACTGCATTGAC
TGTATTTTGTTAACTCCTATATCTAGATCACTTAATTGTCTTTTAGTAGAAGGTTAAGAA
ATAAATTTAAACTATGGAGAGTAAATAAAAGAATATAGCATTTGTCACGATAGCATGAAA
TTAAAACTAATTATCAATATGGAGAAAGAAACTATGTAAAAAAACTTATATGCTCTAATA
GATGAAAATTAAATGAAATAAAAAGATGCTTAGGATAACATGTAAAATTTAGAAACCGAA
ACTAATACAAATAACACATCAAATTAGTAAATAGATTATTTCGAAGAAACAGAAGATTAT
GATAATAAAATGTTAAATTTACACAATTAATATAATTTATAAGATAGAGAAGCAGTATCT
TTTTTTTCAAAATTTGCTCACACATCAAAAATAGTTATCAAACTATAAAAAGGTCTTAAA
ACTGAAAATGCTTTTAAAGAAGAGCTAACAAAAGAATTCTTCATAGATAATGACAATTCA
TTTTTATATTAGCTAACAAATAATGCTCATTTTTAATTTATTTACAACAAATTAACTTAG
CAGTTAAAAATTAAACAAATCTTTCAGTAAACTATTTCTAATTTTGCTTAGAGATCTTTT
TTAGAAATACCTAGAAATTAACCTTTGTAAATTTAAAAGGATACAGTGTTATTTTCACAA
TGTTAACTTAAGTACACATTTGATTTTAAATGA


>TTHERM_00321730(protein)
MEQISLQIQNSLEEAISILKIISNSQEKGLILTDILINDIYFIRNLILSGKEEQLNNYFQ
DLNIIVDKAKLIKNNLTFSCVSKYGNFIQIFQQEPIKVIFQKINSILQNIKKQFPKQIDS
NDVYSLDSKKIEQIFKLHSKLQTFRQYQNMNQFQSYHQLTVLFKMCNDQQGERESLLKSI
ASFILPTSEGQQVDYNSIFKILGIENNNQPISEKSLQLLNIFFQDCWLNRKYLLRLFQQG
CLTSQNKQIAIEQYIPLKDLKLKICNGDFEGVIQSSQSLLLEKNKLQIIGERKVSEMNYQ
HSVNQICKYKLFTLEPYCIDCILLTPISRSLNCLLVEGQEINLNYGEQIKEYSICHDSMK
LKLIINMEKETMQKNLYALIDENQMKQKDAQDNMQNLETETNTNNTSNQQIDYFEETEDY
DNKMLNLHNQYNLQDREAVSFFSKFAHTSKIVIKLQKGLKTENAFKEELTKEFFIDNDNS
FLYQLTNNAHFQFIYNKLTQQLKIKQIFQQTISNFAQRSFLEIPRNQPLQIQKDTVLFSQ
CQLKYTFDFK


>TTHERM_00321730(gene)
TTGTAATATTGAATAATCTATTTTTTTAAACTTTAGATAATAAATTAACATTGATCGATT
AACAAATAGTTAGCAAACTACATATTTTAAAAATAAGAAAGAAAGAAAGATTATGGAACA
AATAAGTCTACAAATACAAAATAGCTTAGAGGAAGCAATCAGCATTTTAAAAATAATTTC
AAACTCATAGGAAAAGGGATTAATATTAACTGATATTTTAATCAACGACATTTACTTCAT
AAGAAATTTGATTCTTTCTGGAAAAGAAGAACAACTAAATAATTATTTTTAAGATTTAAA
CATAATTGTAGACAAAGCTAAATTAATCAAGAACAATCTTACATTTAGCTGTGTTAGTAA
GTATGGAAATTTTATATAAATTTTTCAATAAGAACCCATAAAAGTGATATTCTAAAAAAT
CAACAGCATCCTTCAAAATATCAAAAAATAATTTCCAAAGTAAATAGATTCTAATGATGT
TTATAGCTTAGACTCTAAAAAAATAGAATAAATTTTTAAATTGCATAGTAAATTATAAAC
ATTTAGACAATATTAAAACATGAATTAATTCTAATCTTATCACTAACTCACTGTTCTCTT
TAAAATGTGTAATGACTAATAAGGAGAGAGAGAAAGTCTATTAAAATCTATTGCCTCATT
CATATTACCCACTAGTGTAAATCTTAATTTTTACCTTTTAAATTATTTTTACTAAAGATA
GACTTTTGAGTTATTGATTAGAAATTTGATTAAATATTTAAAAAATCAATTTCATTATAT
TTTATATGGAAAAGGAAGGATAATAGGTAGATTACAATAGCATTTTTAAAATATTAGGAA
TTGAAAATAATAATCAGCCAATAAGTGAAAAGTCTCTTTAGTTGTTAAATATTTTTTTTT
AAGATTGCTGGCTAAACAGGAAATATCTATTAAGATTATTTTAACAAGGTTGTCTGACGA
GTTAAAATAAATAAATTGCTATTGAGTAATATATTCCATTAAAAGACTTAAAACTTAAAA
TATGCAATGGAGACTTTGAAGGAGTGATTCAAAGTTCTCAGTCCTTGCTTTTAGAAAAAA
ATAAATTATAAATCATAGGAGAAAGAAAAGTAAGTGAAATGAATTACTAACATAGTGTTA
ATTAAATATGTAAGTATAAATTATTTACTTTAGAACCTTACTGCATTGACTGTATTTTGT
TAACTCCTATATCTAGATCACTTAATTGTCTTTTAGTAGAAGGTTAAGAAATAAATTTAA
ACTATGGAGAGTAAATAAAAGAATATAGCATTTGTCACGATAGCATGAAATTAAAACTAA
TTATCAATATGGAGAAAGAAACTATGTAAAAAAACTTATATGCTCTAATAGATGAAAATT
AAATGAAATAAAAAGATGCTTAGGATAACATGTAAAATTTAGAAACCGAAACTAATACAA
ATAACACATCAAATTAGTAAATAGATTATTTCGAAGAAACAGAAGATTATGATAATAAAA
TGTTAAATTTACACAATTAATATAATTTATAAGATAGAGAAGCAGTATCTTTTTTTTCAA
AATTTGCTCACACATCAAAAATAGTTATCAAACTATAAAAAGGTCTTAAAACTGAAAATG
CTTTTAAAGAAGAGCTAACAAAAGAATTCTTCATAGATAATGACAATTCATTTTTATATT
AGCTAACAAATAATGCTCATTTTTAATTTATTTACAACAAATTAACTTAGCAGTTAAAAA
TTAAACAAATCTTTCAGTAAACTATTTCTAATTTTGCTTAGAGATCTTTTTTAGAAATAC
CTAGAAATTAACCTTTGTAAATTTAAAAGGATACAGTGTTATTTTCACAATGTTAACTTA
AGTACACATTTGATTTTAAATGATAGCTAAAAAACATTTTATAAGCTGTTTCATATTTTT
GATAAATTAAGTATTTTATAAATAAATAACAGTAATTCACATTCACTTTTTTTCATTTAA
AAATGTTTTTTTTCTTTTAAAATAACAATCTTAAATAGGAGCGACTAAAGACTGATAAAA
TGGATTGGATTGAAAAGTAAAGGAACCATATCCATCCATCAATCCAAAAGTATTTAAATA
CTCAACATCTCCTAAAAATTTTAAGTTGCTGATCTGGATTTTAATCCAGCCAGCTGTTTA
TGTTTATTTACTTCAAAATAATTATTTTTTATTTTTAATCATTAGATTAATCCAA