Identifiers and Description

Gene Model Identifier

TTHERM_00378890

Standard Name

GRL5 (GRanule Lattice )

Aliases

PreTt10343 | 40.m00228

Description

Granule lattice protein; acidic, calcium-binding structural protein of dense core granules; translated as a pro-protein precursor; contains coiled-coil region

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF04012 ) PspA/IM30 family
  • ( PF01920 ) Prefoldin subunit
  • ( PF09325 ) Vps5 C terminal like
  • ( PF00038 ) Intermediate filament protein
  • ( PF06295 ) conserved hypothetical protein
  • ( TIGR01216 ) ATP synthase F1, epsilon subunit
  • ( PF05769 ) Protein of unknown function (DUF837)
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( TIGR01843 ) type I secretion membrane fusion

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00378890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00086.11.0001999920370885e-161granule lattice protein 5 (376
aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60
  2. Ref:14690495: Turkewitz AP (2004) Out with a bang! Tetrahymena as a model system to study secretory granule biogenesis. Traffic (Copenhagen, Denmark) 5(2):63-8
  3. Ref:9450970: Verbsky JW, Turkewitz AP (1998) Proteolytic processing and Ca2+-binding activity of dense-core vesicle polypeptides in Tetrahymena. Molecular biology of the cell 9(2):497-511

Sequences

>TTHERM_00378890(coding)
ATGAGAGTTATTGCTGCCCTCCTCGTTATTGCACTTGTCTGTCAAAGTGCTATGGCTGTT
ACTTCCAAGTCCCAAGCCAAGTTGATGATGGAAAAGATCAACTCTAAGTTGGAAAAATCC
CACCTTGGTCGTGCCTTAAAGGGTATGGTCACCATTGCCACCAAGCTCGGTTATGACTAC
TAAGATCTCTATGATGCCTTCGCTGCCCTCAAGAACTAATTATTAAACAACCTTGACAAC
GAAAATTCCTTATTCGAAACCTAAACCGCTTCCCACGACAGTGCTGTTGCTCAATTCAAC
GCTGACATCAGCAACTACAACGGTCAAATTAACGATGCTTAAGCTTAATTAAACGACCTC
AACGACTCCTTGAACACCTACTAACAAAACTTATAGGATGCTCAACAAGCTCTCTAAGAC
AACACTGATGCTCTCAATGCTGCCGAAGAAGCTCTTGCCAATGCTGAAGCTCTTTACCAA
GTTGCCACCGCTGAATACAGCAATGCTGATTAAGTTATCGGACTCGCTGTTGAAAAACTC
CAAGAAGCTTAATCCCACTACGACAATGCTGACCTCGGATCTTTCTCCTTCGTCTAAATC
AAGAACACCTTCGTTTCTTTCGCCTAAAAGGTCACTGAAGCCACCAAGGGAATGAATGCC
AAGCACTAACTCTTCGTCAAGCCTGTCGTCTAAGCTATGATGTAAGTTAAGAACAACACC
AGTTAATCCTCCATCTAAACTGCCATCAAGGCCCTCCAAGACTTACAAGCTTACTTCCAA
AAGACCTTCTCTGATCTTACCAACGAATACGTTAGCTTCACCTAAAACGTCTAATCCACC
ATTGATGGTCTCAACTAAATTATCGATATCTTACAAAACTAAGTCATCCCTGGATACGAA
GCTCAAATCAGCTCTTTACAAGCTCAAATCTAATAAGTTGAAGATGCTCTCGCTCTTGCC
TAACAAAACTTACAAGATGCTTAAAACGCTCTTGATGCTGAAAACGCTCAATGGGAAAAC
GTCGTAGCTAGACACTAAGCTCTCGTTGACAGAATCAACTCCGAATACGACCTCGTTACC
CAAGCTGACAGAATCGTTAGAAACGCTCAAGCTTAAGTTAACGGCTCTGACTGA


>TTHERM_00378890(protein)
MRVIAALLVIALVCQSAMAVTSKSQAKLMMEKINSKLEKSHLGRALKGMVTIATKLGYDY
QDLYDAFAALKNQLLNNLDNENSLFETQTASHDSAVAQFNADISNYNGQINDAQAQLNDL
NDSLNTYQQNLQDAQQALQDNTDALNAAEEALANAEALYQVATAEYSNADQVIGLAVEKL
QEAQSHYDNADLGSFSFVQIKNTFVSFAQKVTEATKGMNAKHQLFVKPVVQAMMQVKNNT
SQSSIQTAIKALQDLQAYFQKTFSDLTNEYVSFTQNVQSTIDGLNQIIDILQNQVIPGYE
AQISSLQAQIQQVEDALALAQQNLQDAQNALDAENAQWENVVARHQALVDRINSEYDLVT
QADRIVRNAQAQVNGSD


>TTHERM_00378890(gene)
ATGAGAGTTATTGCTGCCCTCCTCGTTATTGCACTTGTCTGTCAAAGTGCTATGGCTGTT
ACTTCCAAGTCCCAAGCCAAGTTGATGATGGAAAAGATCAACTCTAAGTTGGAAAAATCC
CACCTTGGTCGTGCCTTAAAGGGTATGGTCACCATTGCCACCAAGCTCGGTTATGACTAC
TAAGATCTCTATGATGCCTTCGCTGCCCTCAAGAACTAATTATTAAACAACCTTGACAAC
GAAAATTCCTTATTCGAAACCTAAACCGCTTCCCACGACAGTGCTGTTGCTCAATTCAAC
GCTGACATCAGCAACTACAACGGTCAAGTAAAAAAAAATACAATTTTTAAAGAAATATAA
TTTGTGAATAATTAGATTCTCATCCAAAAAAATAAAATAAAATGAATAATATTTAAAATA
AACTAATAAGTTGTTTCTAATTTCACCAACAAACCAAGCAATTAATTGATTCATTGATTG
ATTGATTCTAATATTTTACATTTTATAAATAGATTAACGATGCTTAAGCTTAATTAAACG
ACCTCAACGACTCCTTGAACACCTACTAACAAAACTTATAGGATGCTCAACAAGCTCTCT
AAGACAACACTGATGCTCTCAATGCTGCCGAAGAAGCTCTTGCCAATGCTGAAGCTCTTT
ACCAAGTTGCCACCGCTGAATACAGCAATGCTGATTAAGTTATCGGACTCGCTGTTGAAA
AACTCCAAGAAGCTTAATCGTAAACAAATAATTATCTATTTATTCATTTTGCTTTCATAT
AATTTGCTTTATTAGCAATTAAATGAAATGTTATATCAATCAAGCTTTTGCAATGCATCA
ATAATTAATTTTTTTACAAATAATTATAGCCACTACGACAATGCTGACCTCGGATCTTTC
TCCTTCGTCTAAATCAAGAACACCTTCGTTTCTTTCGCCTAAAAGGTCACTGAAGCCACC
AAGGGAATGAATGCCAAGCACTAACTCTTCGTCAAGCCTGTCGTCTAAGCTATGATGTAA
GTTAAGAACAACACCAGTTAATCCTCCATCTAAACTGCCATCAAGGCCCTCCAAGACTTA
CAAGCTTACTTCCAAAAGACCTTCTCTGATCTTACCAACGAATACGTTAGCTTCACCTAA
AACGTCTAATCCACCATTGATGGTCTCAACTAAATTATCGATATCTTACAAAACTAAGTC
ATCCCTGGATACGAAGCTCAAATCAGCTCTTTACAAGCTCAAATCTAATAAGTTGAAGAT
GCTCTCGCTCTTGCCTAACAAAACTTACAAGATGCTTAAAACGCTCTTGATGCTGAAAAC
GCTCAATGGGAAAACGTCGTAGCTAGACACTAAGCTCTCGTTGACAGAATCAACTCCGAA
TACGACCTCGTTACCCAAGCTGACAGAATCGTTAGAAACGCTCAAGCTTAAGTTAACGGC
TCTGACTGA