Identifiers and Description

Gene Model Identifier

TTHERM_00624730

Standard Name

GRL3 (GRanule Lattice )

Aliases

PreTt07461 | 87.m00241 | 3814.m00941

Description

GRL3 granule lattice protein; ranule lattice protein; acidic- calcium-binding structural protein of dense core granules; translated as a pro-protein precursor; contains coiled-coil region

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 77.4%

TetraMine Data

TTHERM_00624730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12047.19.997093137033517e-262granule lattice protein 3 (378
aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60
  2. Ref:14690495: Turkewitz AP (2004) Out with a bang! Tetrahymena as a model system to study secretory granule biogenesis. Traffic (Copenhagen, Denmark) 5(2):63-8
  3. Ref:11438705: Chilcoat ND, Elde NC, Turkewitz AP (2001) An antisense approach to phenotype-based gene cloning in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 98(15):8709-13
  4. Ref:9450970: Verbsky JW, Turkewitz AP (1998) Proteolytic processing and Ca2+-binding activity of dense-core vesicle polypeptides in Tetrahymena. Molecular biology of the cell 9(2):497-511

Sequences

>TTHERM_00624730(coding)
ATGAAGAATTTAGCTATCGTTTTGGCTACTTTGTGCATTTTTGCTCAAGCCACAAGTGTC
TTCGAGACCCCTGCTTTCCTTGAAATTAAGAGCAACCCCTTCGGTCACACCGTTGCTTCT
TTGGTTTAATTAAACTTAGGTGCTGGATAAAGTGCTGGTAGATTAGATGCTATTGCTGAA
GCCTTGAACACTATTGAAGCTTAACTCGAAAATACCAGAGATCACAATGATGCTGAAATC
CAAAGACAAAGAGGCTGGTGCAGTGATCAAGAAGCTACCATCTAAGCTAACATTGATTAA
GCTGAAAGTGATTTGAGCAACTACTAAAACGAATAAACTTAAAGAAACTAAGCCGTTGCT
GACCTCACCCAAAACTTAAACAACGAATAATAATCCCTCGCTGAAAACTAAAATAACTTA
GCCAACGCCTAATAGGAATTAGATGATGAAAACTCTTCTTATGCTGAATCCTCTAAGGAC
TACGCTGATGCTATTGCTGCTTGTGAATAAGCTCTCAAGCTCTTAGCCACCTTGTAAACT
AACCCCTCCGGTTTCATCTAATCTAAGGCTAGATTCGGTAACGTTGTTACTCTCCTCCAA
AAGCACCTTGCCAACAAGTCTTCCAACTTCGTTCAACCCATCTTGAACGTCTTGACTGAA
ATGGCTAGCTCCACCAACGAAGTTGACTAATCCAGTCTTGCTAAGGTTGTTTCTCTCATT
AACGATTTATTAGAAGAATTAAGAAACTAAAGTGCTGCTAATGACTAAAGACACTAATAA
GTTGTTGATAGCCTCACCTCCAACATTGCAAATCTCGAACAACTTATTGATAATTCTAAC
AACCTTATTTCATAATACTAAGGTTAAATCTAAGAAAATGAAGACAGATTAGCCTAACTT
GCTGGTCTTATCCAACAAACCTAAGCTATCCTTGACTAAGCCAACTAAAATCTTAGCTAA
GTTTAAGATTAATGCGCTGGATACGATCAAGAATATGCTTCTTTCAAGAACGAAGTTGAT
CAATAACTCGCTACCTTATAAGCCCTCAAGGAATATTTCAAGAGCAAGGTTGTTCCTGCT
GTTGAAAACATTAACGATTCTGCTTATGCTGATGAATTAACTGTTGATGTTTGA


>TTHERM_00624730(protein)
MKNLAIVLATLCIFAQATSVFETPAFLEIKSNPFGHTVASLVQLNLGAGQSAGRLDAIAE
ALNTIEAQLENTRDHNDAEIQRQRGWCSDQEATIQANIDQAESDLSNYQNEQTQRNQAVA
DLTQNLNNEQQSLAENQNNLANAQQELDDENSSYAESSKDYADAIAACEQALKLLATLQT
NPSGFIQSKARFGNVVTLLQKHLANKSSNFVQPILNVLTEMASSTNEVDQSSLAKVVSLI
NDLLEELRNQSAANDQRHQQVVDSLTSNIANLEQLIDNSNNLISQYQGQIQENEDRLAQL
AGLIQQTQAILDQANQNLSQVQDQCAGYDQEYASFKNEVDQQLATLQALKEYFKSKVVPA
VENINDSAYADELTVDV


>TTHERM_00624730(gene)
ATGAAGAATTTAGCTATCGTTTTGGCTACTTTGTGCATTTTTGCTCAAGCCACAAGTGTC
TTCGAGACCCCTGCTTTCCTTGAAGTAAGCTATTTCTTAATCTAATAAAGAGATCAGACC
AAATATGAGATAAAGCATTTTATCTTCCCACCTACTTTCACTTTCTCCTCACCTGATAAT
TTAATTATTAATAACTTCTCATGGAGCAACGAGAAGTTACAACTAAGTTAAATTTGATGT
TTAATCAATCGAATACACAAAAGGAGTATCGCGTTGCATAAAAAAAGAAATATATGGAGG
ATACAGCTCTTCACATTCAAAAATTTTTTTATTTAAGATTTCCACTCTTACCCCCAAAGA
ATATAAAAAGAAGATCGCTTATCCTCTTAAGATTAAACAAACAAACAAACAAACATACAG
AATGAGGTTTTCTATAATTTAAGTGTGAAAAGAAATGCGAAAAGTAAAAACAACTAATCA
AATAAACGTCAATCAAAACCAACTGCATTTAATTGAACTAGCTTTAATTTTGCTAAATTA
AAGATGATTCATTCATTAATCCCTCAGTTTTTTTAACTTCTTTAATTTTACAATTAAAGC
TTTTTTATTCTTTTCACATAAACGTTTTGGAAATCAATCAAATTGCAACCAACAAACTCT
TTCCTTAATGGTATATCAGGTGCTTGTTTGAGATTTGTTTTAAGCTAATTGAACCTTTTA
TTCATCTAGCCTTTAACACAGAATATACCCACCATATTATTTTTTTAAGCTCACTAATTT
ATTGAAACTCTGAAGAAGGTGTTTATTCATTTAAAATAAATACAACCATAAAGTTGAATG
AATATGCTTTAATTAATTAATTAATTTTCTTCTGTCTGTCTGACTCTCTTTTTAAAATAT
TTAAAATGTTTAATACTTTTATTAACATTAAATTTTTTTATTAATAGATTAAGAGCAACC
CCTTCGGTCACACCGTTGCTTCTTTGGTTTAATTAAACTTAGGTGCTGGATAAAGTGCTG
GTAGATTAGATGCTATTGCTGAAGCCTTGAACACTATTGAAGCTTAACTCGAAAATACCA
GAGATCACAATGATGCTGAAATCCAAAGACAAAGAGGCTGGTGCAGTGATCAAGAAGCTA
CCATCTAAGCTAACATTGATTAAGCTGAAAGTGATTTGAGCAACTACTAAAACGAATAAA
CTTAAAGAAACTAAGCCGTTGCTGACCTCACCCAAAACTTAAACAACGAATAATAATCCC
TCGCTGAAAACTAAAATAACTTAGCCAACGCCTAATAGGAATTAGATGATGAAAACTCTT
CTTATGCTGAATCCTCTAAGGACTACGCTGATGCTATTGCTGCTTGTGAATAAGCTCTCA
AGCTCTTAGCCACCTTGTAAACTAACCCCTCCGGTTTCATCTAATCTAAGGCTAGATTCG
GTAACGTTGTTACTCTCCTCCAAAAGCACCTTGCCAACAAGTCTTCCAACTTCGTTCAAC
CCATCTTGAACGTCTTGACTGAAATGGCTAGCTCCACCAACGAAGTTGACTAATCCAGTC
TTGCTAAGGTTGTTTCTCTCATTAACGATTTATTAGAAGAATTAAGAAACTAAAGTGCTG
CTAATGACTAAAGACACTAATAAGTTGTTGATAGCCTCACCTCCAACATTGCAAATCTCG
AACAACTTATTGATAATTCTAACAACCTTATTTCATAATACTAAGGTTAAATCTAAGAAA
ATGAAGACAGATTAGCCTAACTTGCTGGTCTTATCCAACAAACCTAAGCTATCCTTGACT
AAGCCAACTAAAATCTTAGCTAAGTTTAAGATTAATGCGCTGGATACGATCAAGAATATG
CTTCTTTCAAGAACGAAGTGTAATTAATCTATTTATTCATTCATTTCTCCATATTTTCAT
TTATTTATTTTACTCCTACTTATAATGAATAATTTATTTAATTATATTTATATTAATAGT
GATCAATAACTCGCTACCTTATAAGCCCTCAAGGAATATTTCAAGAGCAAGGTTGTTCCT
GCTGTTGAAAACATTAACGATTCTGCTTATGCTGATGAATTAACTGTTGATGTTTGA