Identifiers and Description

Gene Model Identifier

TTHERM_00473020

Standard Name

GRL2 (GRanule Lattice )

Aliases

PreTt02202 | 57.m00141 | 3709.m00002

Description

Granule lattice protein; transcripts present at low levels; not essential for core assembly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF01920 ) Prefoldin subunit
  • ( PF08945 ) Bcl-x interacting
  • ( PF08946 ) Osmosensory transporter coiled coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 87.9%

TetraMine Data

TTHERM_00473020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_21770
Tetrahymena borealisEI9_13082.17.996110620510222e-164hypothetical protein (405 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60

Sequences

>TTHERM_00473020(coding)
ATGCGCTTAACTGTTATTGTCACCCTATCATTATTGTTTGGGTGTATAATGGCTGCTGAA
GCTGAAGCAGAATTAGAGGCTACTTATGAAATTGATAATGCCTTAGAAGCATTAACTGAA
TTGAGGGATGATACTGCATTATCTTTGTACAATTTACAAAAGGGATGGGCAGTAGTAAAG
GATGGATTGTAAGATTCAGAAAATTAATTATAAAACTCAATCAATTAAAAGGATGCAGAG
TGCGCTAATCTTGATTAAGCTAGAAATCAAACTTAATCTGACCTTGATGAAATTAATGCC
TACATCCCATGGTTAGAATAGAAAATAGCAAATATTACAGATAGTTTAAACTCTTTACTT
TAAAGAAGATGTGATCTTAATAAAGCATTCCTTGATCATATCTAAAGAGAAAAGATCGCT
TTGAGTTTACTTGAATTTATTAAATCTGCTATTCAAAATAAGGATTCATTTGATTTTGTC
CAAATGAGAAAGCTTAACAAAAATTTCTAATAATTCTTAATTGCATACAGTGCACACGAC
TTCAGTTCCATCTTACTTCTATAAAAAGATATTGTAGATTCAAAGGATTATGAAGTTGAT
GTCGATTTCTCAACTAAAGATAGAACTGAGGAAGAAATTGGTACTGGTCACATTGATAAT
AATAAGGGAGATCTTGATTTGGAAGACTTCACTGAAGGAAAGAGAAAGAATTGGTAACTT
TACAAATAAGAACTTCTTGATATCCTTAACGAATTATAAGCTAAGATCCAAGCCAATATT
AAGAGTTCTATTGATGATGAAATCGCTGCATCTGTAACCCTTGCTAACTACAAGAATAAC
GCCTTGAAGGAAATTTAAGCCTACGAAAAGGAACTTGCTAAGGCTAAAAAGTAATAAGTC
TAATTATAGGCATAACTTGACGATGAATAGAATGCTCTCACTTAATGCAGATCTCAGGAT
GATAGCTTAAAGAACTAACTTTAATCTCTTCAAAATGAAATATAGCAAAGATAAGCAGAA
TTCGATAAGAAGAAGGATGATCTCTAAGGACAAGTTGATTTATTCAACGAAATTATTACT
GAATATCAAGATGGTATATTCTCTCAAGGTGATGACTTTAAGGGCCGTACAGATGATTAT
TTAGATAACTAGACCTTCGATGATGATGCCACTTATACAGGTAGAGAAGTACCTAAAATT
GATTTTATGAATAACCAAGATGCTAATGGAAGTGCTAGTTCTGGTGGATTCTGA


>TTHERM_00473020(protein)
MRLTVIVTLSLLFGCIMAAEAEAELEATYEIDNALEALTELRDDTALSLYNLQKGWAVVK
DGLQDSENQLQNSINQKDAECANLDQARNQTQSDLDEINAYIPWLEQKIANITDSLNSLL
QRRCDLNKAFLDHIQREKIALSLLEFIKSAIQNKDSFDFVQMRKLNKNFQQFLIAYSAHD
FSSILLLQKDIVDSKDYEVDVDFSTKDRTEEEIGTGHIDNNKGDLDLEDFTEGKRKNWQL
YKQELLDILNELQAKIQANIKSSIDDEIAASVTLANYKNNALKEIQAYEKELAKAKKQQV
QLQAQLDDEQNALTQCRSQDDSLKNQLQSLQNEIQQRQAEFDKKKDDLQGQVDLFNEIIT
EYQDGIFSQGDDFKGRTDDYLDNQTFDDDATYTGREVPKIDFMNNQDANGSASSGGF


>TTHERM_00473020(gene)
ATGCGCTTAACTGTTATTGTCACCCTATCATTATTGTTTGGGTGTATAATGGCTGCTGAA
GCTGAAGCAGAATTAGAGGCTACTTATGAAATTGATAATGCCTTAGAAGCATTAACTGAA
TTGAGGGATGATACTGCATTATCTTTGTACAATTTACAAAAGGGATGGGCAGTAGTAAAG
GATGGATTGTAAGATTCAGAAAATTAATTATAAAACTCAATCAATTAAAAGGATGCAGAG
TGCGCTAATCTTGATTAAGCTAGAAATCAAACTTAATCTGACCTTGATGAAATTAATGCC
TACATCCCATGGTTAGAATAGAAAATAGCAAATATTACAGATAGTTTAAACTCTTTACTT
TAAAGAAGATGTGATCTTAATAAAGCATTCCTTGATCATATCTAAAGAGAAAAGATCGCT
TTGAGTTTACTTGAATTTATTAAATCTGCTATTCAAAATAAGGATTCATTTGATTTTGTC
CAAATGAGAAAGCTTAACAAAAATTTCTAATAATTCTTAATTGCATACAGTGCACACGAC
TTCAGTTCCATCTTACTTCTATAAAAAGATATTGTAGATTCAAAGGATTATGAAGTTGAT
GTCGATTTCTCAACTAAAGATAGAACTGGTATTATTTTTACTTGAATTTTAAAAGGATTT
TAAATAAGTAATCAGACAGACTTAAAATGATCAATATACATTAAAAATGTTTGAAAATAA
GTTTAAATAATTTAGGATTTCTTTCCATTTAAATAGATTCAAAAAAAATCGAGAAATCAA
TATAGATAAATAAATGGCTTAGTTAATTAATTAATTGAGATGCTGAATAACGTCAATTTA
TTATTTTAATTAATTTAAAAGAATTTAAAATTATTAGCCTAAAAAAAATATTTTAAAAAA
ATGAACAATTTATTTTTAAATTGCATACGAAATTCTATCAATAAATACAAATTAATTTTA
ATATAATATTTTTTTTTTAAAAATTAAATAGAGGAAGAAATTGGTACTGGTCACATTGAT
AATAATAAGGGAGATCTTGATTTGGAAGACTTCACTGAAGGAAAGAGAAAGAATTGGTAA
CTTTACAAATAAGAACTTCTTGATATCCTTAACGAATTATAAGCTAAGATCCAAGCCAAT
ATTAAGAGTTCTATTGATGATGAAATCGCTGCATCTGTAACCCTTGCTAACTACAAGAAT
AACGCCTTGAAGGAAATTTAAGCCTACGAAAAGGAACTTGCTAAGGCTAAAAAGTAATAA
GTCTAATTATAGGCATAACTTGACGATGAATAGAATGCTCTCACTTAATGCAGATCTCAG
GATGATAGCTTAAAGAACTAACTTTAATCTCTTCAAAATGAAATATAGCAAAGATAAGCA
GAATTCGATAAGAAGAAGGATGATCTCTAAGGACAAGTTGATTTATTCAACGAAATTATT
ACTGAATATCAAGATGGTATATTCTCTCAAGGTGATGACTTTAAGGGCCGTACAGATGAT
TATTTAGATAACTAGACCTTCGATGATGATGCCACTTATACAGGTAGAGAAGTACCTAAA
ATTGATTTTATGAATAACCAAGATGCTAATGGAAGTGCTAGTTCTGGTGGATTCTGA