Identifiers and Description

Gene Model Identifier

TTHERM_00527180

Standard Name

GRL1 ( GRanule Lattice)

Aliases

PreTt06450 | 66.m00249 | p40 | 3722.m00106

Description

Acidic, calcium-binding structural protein of dense core granules; translated as a pro-protein precursor; contains coiled-coil region; assembles into a lattice capable of regulated expansion; necessary for proper granule size and shape

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08647 ) BRE1 E3 ubiquitin ligase
  • ( PF08311 ) Mad3/BUB1 homology region 1
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF06909 ) Protein of unknown function (DUF1274)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00527180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13447.19.997093137033517e-262hypothetical protein (403 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15958493: Cowan AT, Bowman GR, Edwards KF, Emerson JJ, Turkewitz AP (2005) Genetic, genomic, and functional analysis of the granule lattice proteins in Tetrahymena secretory granules. Molecular biology of the cell 16(9):4046-60
  2. Ref:14690495: Turkewitz AP (2004) Out with a bang! Tetrahymena as a model system to study secretory granule biogenesis. Traffic (Copenhagen, Denmark) 5(2):63-8
  3. Ref:15537088: Jacobs ME, Cortezzo DE, Klobutcher LA (2004) Assessing the effectiveness of coding and non-coding regions in antisense ribosome inhibition of gene expression in Tetrahymena. The Journal of eukaryotic microbiology 51(5):536-41
  4. Ref:12435750: Bradshaw NR, Chilcoat ND, Verbsky JW, Turkewitz AP (2003) Proprotein processing within secretory dense core granules of Tetrahymena thermophila. The Journal of biological chemistry 278(6):4087-95
  5. Ref:11779800: Bowman GR, Turkewitz AP (2001) Analysis of a mutant exhibiting conditional sorting to dense core secretory granules in Tetrahymena thermophila. Genetics 159(4):1605-16
  6. Ref:9450970: Verbsky JW, Turkewitz AP (1998) Proteolytic processing and Ca2+-binding activity of dense-core vesicle polypeptides in Tetrahymena. Molecular biology of the cell 9(2):497-511
  7. Ref:9380694: Haddad A, Turkewitz AP (1997) Analysis of exocytosis mutants indicates close coupling between regulated secretion and transcription activation in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 94(20):10675-80
  8. Ref:8991090: Chilcoat ND, Melia SM, Haddad A, Turkewitz AP (1996) Granule lattice protein 1 (Grl1p), an acidic, calcium-binding protein in Tetrahymena thermophila dense-core secretory granules, influences granule size, shape, content organization, and release but not protein sorting or condensation. The Journal of cell biology 135(6 Pt 2):1775-87
  9. Ref:2065648: Turkewitz AP, Madeddu L, Kelly RB (1991) Maturation of dense core granules in wild type and mutant Tetrahymena thermophila. The EMBO journal 10(8):1979-87

Sequences

>TTHERM_00527180(coding)
ATGAATAAGAAATTATTAGTTGTCCTTTTCGGATTCCTCGCTTTGGCTGCTGCTACCAAC
CAAAGTGAAGAAGAAGGTTCTTACACCATCGATCAAGCTGCAAATCTTTTAAATGACTTA
CTTGCAGATTCTCAACAAAATTTGAGCGATCTCCAAGCTGCATGGGCCAATAAGGAACCT
CTTTTACAAGGTGTTATTGCTGGACTTGAAAGCGATCTTGCCAACAAGTAAGCTGAATGC
GCTGATCTCTAAGGTACCCTTGATGCTGATTAAGCTTCCCTCGATGAAGCTGAAGCATAC
GTTGCCTGGTTATAAGACAGAATTGCTGCTAACCATAAGCAAATTGACGACTTACTCAAC
AGAAGATGTCAACAAAACGGTAACTACATTGAAGGTCTTAAGAACGACAAGCTCGCTCTT
GCTCTCTTATAATTCCTTGAAGCCTAAATTCAAAACAAGGAATCCTTCTCTTTCCTCCAA
AAGAAGAACTTCATGAAGAAACTCACCCGTTTCTTGAGCATCTACAAAACTGGTAACTAT
TAATAACTCGCTCTCCTTGAAAAGGAATACGTTAACGCTGATGACTACTCAGTTAATCCC
GACTACTCTACTGGTGACAGAACTGCTGACGAAATCGGATCTGGTCACATTGATAACGAC
AAGGGTGATATCGATGTTGCTGACTTCTAAGAAGGTGAAAGAAAGGGATGGTACTAAGTC
AAATAAGAATTATTAGACCTCTTACACAACTTAGAATAAACTATTGAAGCCAAGATCTAA
TAAGCTTAAGAAGATGAAGTTAACTCCAACTCCGCTGCTGCTGACTTCAAGAGCAAACTT
GAACACGAAATCCAAGTCTATGAAAGAGAACTTGCTAAGTGGTAATAAACCGTTGCTGCT
TTGACTGCCACCGTTGCTTAAGACCACGAAAACGTTAACAACTGTCACTCCTAAGAAGCT
GCCATCCAAGCTAACCTCGATGCTGCTAATTAAGACTATGCCAATGAAAAGGCTACCTTC
GAACACAAGCAAGCCAACTTACAAGAAGAAATCGAAATCTTCATTGAAGTTATTGCTTAC
TATGACGATAACGTCCAAAATGCCGGTGAAGACTTAAAGGAAAGAGTCGAAGATTATAGT
GATGGTAACTTCGATGATGCCGCCACCTACGAAAATAGATAAGTCCCCAATATTGACTTC
ATTAACTGA


>TTHERM_00527180(protein)
MNKKLLVVLFGFLALAAATNQSEEEGSYTIDQAANLLNDLLADSQQNLSDLQAAWANKEP
LLQGVIAGLESDLANKQAECADLQGTLDADQASLDEAEAYVAWLQDRIAANHKQIDDLLN
RRCQQNGNYIEGLKNDKLALALLQFLEAQIQNKESFSFLQKKNFMKKLTRFLSIYKTGNY
QQLALLEKEYVNADDYSVNPDYSTGDRTADEIGSGHIDNDKGDIDVADFQEGERKGWYQV
KQELLDLLHNLEQTIEAKIQQAQEDEVNSNSAAADFKSKLEHEIQVYERELAKWQQTVAA
LTATVAQDHENVNNCHSQEAAIQANLDAANQDYANEKATFEHKQANLQEEIEIFIEVIAY
YDDNVQNAGEDLKERVEDYSDGNFDDAATYENRQVPNIDFIN


>TTHERM_00527180(gene)
AACAATCAATTAAAGTCTTTTTGCAAAGTGATAATAAAAATTAAAAAACGAAAAAAAAAT
AATAATAATTAATATACAAAACATAAAAACTAAAAATTAAAAAGGAAAAAGCATTCATCC
AGACAAATGAATAAGAAATTATTAGTTGTCCTTTTCGGATTCCTCGCTTTGGCTGCTGCT
ACCAACCAAAGTGAAGAAGAAGGTTCTTACACCATCGATCAAGCTGCAAATCTTTTAAAT
GACTTACTTGCAGATTCTCAACAAAATTTGAGCGATCTCCAAGCTGCATGGGCCAATAAG
GAACCTCTTTTACAAGGTGTTATTGCTGGACTTGAAAGCGATCTTGCCAACAAGTAAGCT
GAATGCGCTGATCTCTAAGGTACCCTTGATGCTGATTAAGCTTCCCTCGATGAAGCTGAA
GCATACGTTGCCTGGTTATAAGACAGAATTGCTGCTAACCATAAGCAAATTGACGACTTA
CTCAACAGAAGATGTCAACAAAACGGTAACTACATTGAAGGTCTTAAGAACGACAAGCTC
GCTCTTGCTCTCTTATAATTCCTTGAAGCCTAAATTCAAAACAAGGAATCCTTCTCTTTC
CTCCAAAAGAAGAACTTCATGAAGAAACTCACCCGTTTCTTGAGCATCTACAAAACTGGT
AACTATTAATAACTCGCTCTCCTTGAAAAGGAATACGTTAACGCTGATGACTACTCAGTT
AATCCCGACTACTCTACTGGTGACAGAACTGGTAAATAAACTACATTATATATTAAATCT
CATTTTAATAAATCCAAGATATAAATTTTATTTTTTCTAATTCAAATGCTCTCTCTAAAA
ATGAATATCTATCTAACATCCTAAATAAACAGTCTCAATTATCAATTAAAAATGTTCTCT
ACAAAATCAATGAAAGGAATGAATCAGTCAATTAATTAATTTGAATATTTTATATTGAGA
ACAAGCAAAATCTCTTAACAGTTACTGCATCATCATGCACACTAACATTGATACATACAT
ATGATACATATGAAATTATTAAATTGAACATAGAATATAATATTTAAGATTCACTCAAAC
ATATATAAATAAATAAATGCTTCAAGCAAATAATAAAAAGAATACTGACTGACGAATTTA
AATATTTATTGAATGAATTATTGATTGATTAAACGATAATGAATAAATGATTTTGCAATT
AATTTTTATTAAATGAATGAGATGACATTTGAAAAATGAAGAAAATCAATTATAATTAAA
ATCCATATTTTAAAATTTTCTTTTCAAAAATAAAGCTGACGAAATCGGATCTGGTCACAT
TGATAACGACAAGGGTGATATCGATGTTGCTGACTTCTAAGAAGGTGAAAGAAAGGGATG
GTACTAAGTCAAATAAGAATTATTAGACCTCTTACACAACTTAGAATAAACTATTGAAGC
CAAGATCTAATAAGCTTAAGAAGATGAAGTTAACTCCAACTCCGCTGCTGCTGACTTCAA
GAGCAAACTTGAACACGAAATCCAAGTCTATGAAAGAGAACTTGCTAAGTGGTAATAAAC
CGTTGCTGCTTTGACTGCCACCGTTGCTTAAGACCACGAAAACGTTAACAACTGTCACTC
CTAAGAAGCTGCCATCCAAGCTAACCTCGATGCTGCTAATTAAGACTATGCCAATGAAAA
GGCTACCTTCGAACACAAGCAAGCCAACTTACAAGAAGAAATCGAAATCTTCATTGAAGT
TATTGCTTACTATGACGATAACGTCCAAAATGCCGGTGAAGACTTAAAGGAAAGAGTCGA
AGATTATAGTGATGGTAACTTCGATGATGCCGCCACCTACGAAAATAGATAAGTCCCCAA
TATTGACTTCATTAACTGA