Identifiers and Description

Gene Model Identifier

TTHERM_00141170

Standard Name

GPX9 (Glutathione PeroXidase)

Aliases

PreTt26622 | 11.m00319 | 3702.m00044

Description

Glutathione peroxidase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00255 ) glutathione peroxidase
  • ( PF08534 ) redoxin family protein
  • ( PF00578 ) antioxidant, AhpC/TSA family
  • ( TIGR02540 ) putative glutathione peroxidase Gpx7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00141170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04856.11.0001366335892501e-125glutathione peroxidase (188 aa
)
OxytrichaContig14526.0.g103.998097515166115e-39Glutathione peroxidase
WormBaseWBGene000091653.9990760533890984e-36locus:gpx-1 Glutathione pero
xidase 1 status:Partially_co
nfirmed UniProt:O02621 pro
tein_id:CAB03004.1
SGDYIR037W8.00089003463867e-30HYR1 Thiol peroxidase that fun
ctions as a hydroperoxide rece
ptor to sense intracellular hy
droperoxide levels and transdu
ce a redox signal to the Yap1p
transcription factor
Stentor CoeruleusSteCoe_409055.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00141170(coding)
ATGCACCATAAATTAATATTAAATTAAATTAATCAAAACAAAAATTCAATTTAATAAAAG
CAATTAGAAAATAAAATGGGTAGTTTGTTATTCAAAGCTGTAGCTAAAACTGATTATGAA
AATATAAAACCTACTTAAGATAATTTCTTCAATTATTCTGCAAAAGATATTGATGGCAAT
TTAAGAAATATGAGTGAATTTAAGGATAGAAAGTGCCTTTTAGTTGTTAATGTTGCATGC
AAGTGCGGTTTAACCTCAGATCACTATACCTAATTAGTTTAACTCTATAAGAAATATAAA
TCATAAGGATTTGAAATCTTAGCATTCCCTGCAAACTAATTCATGGGCTAAGAACCTTGG
GATAATGCAAAAATCAAAGAATACGTCGTAACAAACTTTAATGTTGACTTTACTCTTTTC
GACAAAGTAGAGGTAAATGGAGAAAACTGTAATGAAATCTTCAAATTCCTCAGATTTAAC
TCTGAGCTTCATAACAAAGAAACAGGTAAAACTAGATAGATTCCTTGGAACTTTGCTAAA
TTTTTAATTGGACCCGATGGTAAGGTTCATAAATTTGCTAGTCCTAAAGTTAATCCTAAC
GATATGATAGCTGATATTGAAGCTATGCTTAAAGCTTGA


>TTHERM_00141170(protein)
MHHKLILNQINQNKNSIQQKQLENKMGSLLFKAVAKTDYENIKPTQDNFFNYSAKDIDGN
LRNMSEFKDRKCLLVVNVACKCGLTSDHYTQLVQLYKKYKSQGFEILAFPANQFMGQEPW
DNAKIKEYVVTNFNVDFTLFDKVEVNGENCNEIFKFLRFNSELHNKETGKTRQIPWNFAK
FLIGPDGKVHKFASPKVNPNDMIADIEAMLKA


>TTHERM_00141170(gene)
ATGCACCATAAATTAATATTAAATTAAATTAATCAAAACAAAAATTCAATTTAATAAAAG
CAATTAGAAAATAAAATGGGTAGTTTGTTATTCAAAGCTGTAGCTAAAACTGATTATGAA
AATATAAAACCTACTTAAGATAATTTCTTCAATTATTCTGCAAAAGATATTGATGGCAAT
TTAAGAAATATGAGTGAATTTAAGGATAGAAAGTGCCTTTTAGTTGTTAATGTTGCATGC
AAGTGCGGTTTAACCTCAGATCACTATACCTAATTAGTTTAACTCTATAAGAAATATAAA
TCATAAGGATTTGAAATCTTAGCATTCCCTGCAAACTAATTCATGGGCTAAGAACCTTGG
GATAATGCAAAAATCAAAGAATACGTCGTAACAAACTTTAATGTTGACTTTACTCTTTTC
GACAAAGTAGAGGTAAATGGAGAAAACTGTAATGAAATCTTCAAATTCCTCAGATTTAAC
TCTGAGCTTCATAACAAAGAAACAGGTAAAACTAGATAGATTCCTTGGAACTTTGCTAAA
TTTTTAATTGGACCCGATGGTAAGGTTCATAAATTTGCTAGTCCTAAAGTTAATCCTAAC
GATATGATAGCTGATATTGAAGCTATGCTTAAAGCTTGA