Identifiers and Description

Gene Model Identifier

TTHERM_00046090

Standard Name

GPX8 (Glutathione PeroXidase)

Aliases

PreTt11088 | 3.m01698 | 3824.m02849

Description

GPX8 phospholipid hydroperoxide glutathione peroxidase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00046090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04855.19.997962730346853e-122glutathione peroxidase (186 aa
)
OxytrichaContig14526.0.g103.0001084582952455e-37Glutathione peroxidase
SGDYBR244W4.000054831110256e-33GPX2 Phospholipid hydroperoxid
e glutathione peroxidase induc
ed by glucose starvation that
protects cells from phospholip
id hydroperoxides and nonphosp
holipid peroxides during oxida
tive stress
WormBaseWBGene000203739.99967697349061e-30locus:gpx-6 Glutathione pero
xidase status:Confirmed Un
iProt:H2KYJ6 protein_id:CCD6
3560.1
Stentor CoeruleusSteCoe_409038.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046090(coding)
ATGGGATCTGTTTTATTGAGCTGCATGCAAAAAAGCAATTTAGAAGAAGTTAAGGTTTCA
CCAGCTAAAGATAATTTTTTTGCATTTGAAGCTATTGACAATGATGGTAAACTTAGAAAG
ATGAGTGAGTTTAAGAATAAAAAATGCATCCTCGTAGTAAATGTAGCTTGCAAGTGTGGA
TTAACCTCAGACCACTACAAATAGTTAGTTGAAATTTACAAATAATACAAGTCTAGAGGT
TTTGAAATTCTGGCTTTCCCAACAAATGATTTCATGGAATAAGAACCTTGGGATAATAAC
AAAATCAAAGAATATGTTTAGACTAATTTTAATGTTGATTTCTAGCTATTTGATAAGATT
TAAGTGAATGGAGAAAATTGTCATGAAATTTATAAATTTTTAAGATTTAATTCTGAATTG
CATGACTCCAAGACTGGAAAGACTAGATAAATACCTTGGAACTTTGCTAAATTTTTAATA
AATCCACAAGGAAAAGTAGTGAAGTTCGTAAGCCCTAAATACAATCCAGAAGTAATGATA
CCTGATATTGAAGCTATGCTTGATGCTTGA


>TTHERM_00046090(protein)
MGSVLLSCMQKSNLEEVKVSPAKDNFFAFEAIDNDGKLRKMSEFKNKKCILVVNVACKCG
LTSDHYKQLVEIYKQYKSRGFEILAFPTNDFMEQEPWDNNKIKEYVQTNFNVDFQLFDKI
QVNGENCHEIYKFLRFNSELHDSKTGKTRQIPWNFAKFLINPQGKVVKFVSPKYNPEVMI
PDIEAMLDA


>TTHERM_00046090(gene)
ATGGGATCTGTTTTATTGAGCTGCATGCAAAAAAGCAATTTAGAAGAAGTTAAGGTTTCA
CCAGCTAAAGATAATTTTTTTGCATTTGAAGCTATTGACAATGATGGTAAACTTAGAAAG
ATGAGTGAGTTTAAGAATAAAAAATGCATCCTCGTAGTAAATGTAGCTTGCAAGTGTGGA
TTAACCTCAGACCACTACAAATAGTTAGTTGAAATTTACAAATAATACAAGTCTAGAGGT
TTTGAAATTCTGGCTTTCCCAACAAATGATTTCATGGAATAAGAACCTTGGGATAATAAC
AAAATCAAAGAATATGTTTAGACTAATTTTAATGTTGATTTCTAGCTATTTGATAAGATT
TAAGTGAATGGAGAAAATTGTCATGAAATTTATAAATTTTTAAGATTTAATTCTGAATTG
CATGACTCCAAGACTGGAAAGACTAGATAAATACCTTGGAACTTTGCTAAATTTTTAATA
AATCCACAAGGAAAAGTAGTGAAGTTCGTAAGCCCTAAATACAATCCAGAAGTAATGATA
CCTGATATTGAAGCTATGCTTGATGCTTGA