Identifiers and Description

Gene Model Identifier

TTHERM_00046110

Standard Name

GPX7 (Glutathione PeroXidase)

Aliases

PreTt11090 | 3.m01967 | 3824.m02851

Description

Glutathione peroxidase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00046110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04855.11.9992982665753866e-121glutathione peroxidase (186 aa
)
OxytrichaContig14526.0.g102.00017271388466e-38Glutathione peroxidase
SGDYBR244W2.0003218023735366e-33GPX2 Phospholipid hydroperoxid
e glutathione peroxidase induc
ed by glucose starvation that
protects cells from phospholip
id hydroperoxides and nonphosp
holipid peroxides during oxida
tive stress
WormBaseWBGene000203736.997498932278805e-30locus:gpx-6 Glutathione pero
xidase status:Confirmed Un
iProt:H2KYJ6 protein_id:CCD6
3560.1
Stentor CoeruleusSteCoe_409053.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046110(coding)
ATGGGATCTGTTTTACTTAGTTGTGTGCAAAAAAAAGGCTTAGAATAAATTAAGGTTTCA
CCAGCTAAAGATAATTTCTTTGCATTTGAAGCTGTTGATAATGATGGTAAACTTAGAAAG
ATGAGTGAGTTTAAGAATAAAAAATGCATCCTCGTAGTAAATGTAGCTTGCAAGTGTGGA
TTAACCTCAGACCACTACAAATAGTTAGTTTAAATTTACAAATAATACAAATCTAGAGGT
TTTGAAATTCTGGCTTTCCCAACAAATGATTTCATGGAATAAGAACCTTGGGATAATAAG
AAAATCAAAGAATATGTTTAGACTAATTTTAATGTGGATTTCTAGCTATTTGATAAGATT
TAAGTGAATGGAGAAAACTGTCATGAAATTTATAAATTTTTAAGATTTAACTCTGAATTA
CATGACTCCAAGACTGGAAAGACTAGATAAATACCTTGGAATTTCGCTAAATTTTTAATA
GACCCAGAAGGAAAAGTAGTGAAATTCGTAAACCCTAAACACAATCCAGAAGTTTTGATA
CCTGATATTGAAGCTATGCTTAATGCATGA


>TTHERM_00046110(protein)
MGSVLLSCVQKKGLEQIKVSPAKDNFFAFEAVDNDGKLRKMSEFKNKKCILVVNVACKCG
LTSDHYKQLVQIYKQYKSRGFEILAFPTNDFMEQEPWDNKKIKEYVQTNFNVDFQLFDKI
QVNGENCHEIYKFLRFNSELHDSKTGKTRQIPWNFAKFLIDPEGKVVKFVNPKHNPEVLI
PDIEAMLNA


>TTHERM_00046110(gene)
ATGGGATCTGTTTTACTTAGTTGTGTGCAAAAAAAAGGCTTAGAATAAATTAAGGTTTCA
CCAGCTAAAGATAATTTCTTTGCATTTGAAGCTGTTGATAATGATGGTAAACTTAGAAAG
ATGAGTGAGTTTAAGAATAAAAAATGCATCCTCGTAGTAAATGTAGCTTGCAAGTGTGGA
TTAACCTCAGACCACTACAAATAGTTAGTTTAAATTTACAAATAATACAAATCTAGAGGT
TTTGAAATTCTGGCTTTCCCAACAAATGATTTCATGGAATAAGAACCTTGGGATAATAAG
AAAATCAAAGAATATGTTTAGACTAATTTTAATGTGGATTTCTAGCTATTTGATAAGATT
TAAGTGAATGGAGAAAACTGTCATGAAATTTATAAATTTTTAAGATTTAACTCTGAATTA
CATGACTCCAAGACTGGAAAGACTAGATAAATACCTTGGAATTTCGCTAAATTTTTAATA
GACCCAGAAGGAAAAGTAGTGAAATTCGTAAACCCTAAACACAATCCAGAAGTTTTGATA
CCTGATATTGAAGCTATGCTTAATGCATGA