Identifiers and Description

Gene Model Identifier

TTHERM_01099010

Standard Name

GPX3 (Glutathione PeroXidase )

Aliases

PreTt20571 | 232.m00038

Description

Glutathione peroxidase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00255 ) glutathione peroxidase
  • ( PF08534 ) redoxin family protein
  • ( PF00578 ) antioxidant, AhpC/TSA family
  • ( TIGR02540 ) putative glutathione peroxidase Gpx7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_01099010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19376.11.0001689416974253e-96glutathione peroxidase (171 aa
)
SGDYBR244W3.9997566980151843e-38GPX2 Phospholipid hydroperoxid
e glutathione peroxidase induc
ed by glucose starvation that
protects cells from phospholip
id hydroperoxides and nonphosp
holipid peroxides during oxida
tive stress
WormBaseWBGene000091653.0013534825799953e-36locus:gpx-1 Glutathione pero
xidase 1 status:Partially_co
nfirmed UniProt:O02621 pro
tein_id:CAB03004.1
OxytrichaContig14526.0.g106.0018235484001396e-36Glutathione peroxidase
Stentor CoeruleusSteCoe_409035.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01099010(coding)
ATGGCTGATAATATAAATATTGCATCCATATTTGATGTCAGAGCAATAGACATTGATGGA
AATGAGTGTCAACTTAGTAAATTTAAGGGTAAAAAAGCATATTTAATAGTAAATGTAGCT
AGTAAGTGTGGATTTACTTCAACAAATTATAAACAGCTATATGAGATATATAAAAACTAT
AGTGATAAAGGCTTAGAAATTTTGGCATTTCCTTCTAATTAATTTTTTAATTAAGAGCCA
TTTGATGAACCTGCAATTAAAGAATTTGTAAAAAAAGAATATAATGTTGATTTTCCTATG
TTTAAAAAGATTTATGTTAATGGAGAAAAAAGACATGACTTATATAAGTATTTAGCAAAT
AATACTCCTGGATTTTAAGGCTATATTTAATGGAATTTCGCTAAATTTTTAGTTAATGCT
GAGGGAAAACCAGTTTAATATTATGAACATAAATAAAATCCTGTAGATATTGTTCCTGAT
ATATTAAAATTATTAAATGGAGAATGA


>TTHERM_01099010(protein)
MADNINIASIFDVRAIDIDGNECQLSKFKGKKAYLIVNVASKCGFTSTNYKQLYEIYKNY
SDKGLEILAFPSNQFFNQEPFDEPAIKEFVKKEYNVDFPMFKKIYVNGEKRHDLYKYLAN
NTPGFQGYIQWNFAKFLVNAEGKPVQYYEHKQNPVDIVPDILKLLNGE


>TTHERM_01099010(gene)
ATGGCTGATAATATAAATATTGCATCCATATTTGATGTCAGAGCAATAGACATTGATGGA
AATGAGTGTCAACTTAGTAAATTTAAGGGTAAAAAAGCATATTTAATAGTAAATGTAGCT
AGTAAGTGTGGATTTACTTCAACAAATTATAAACAGCTATATGAGATATATAAAAACTAT
AGGTAAAATATTTTCTATTCAGAGTATAAAAAGTTTAAAAATTATTTTATTATGTCAGTG
ATAAAGGCTTAGAAATTTTGGCATTTCCTTCTAATTAATTTTTTAATTAAGAGCCATTTG
ATGAACCTGCAATTAAAGAATTTGTAAAAAAAGAATATAATGTTGATTTTCCTATGTTTA
AAAAGATTTATGTTAATGGAGAAAAAAGACATGACTTATATAAGTATTTAGCAAATAATA
CTCCTGGATTTTAAGGCTATATTTAATGGAATTTCGCTAAATTTTTAGTTAATGCTGAGG
GAAAACCAGTTTAATATTATGAACATAAATAAAATCCTGTAGATATTGTTCCTGATATAT
TAAAATTATTAAATGGAGAATGA