Identifiers and Description

Gene Model Identifier

TTHERM_00895660

Standard Name

GPX2 (Glutathione PeroXidase )

Aliases

PreTt21948 | 159.m00056

Description

Glutathione peroxidase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00255 ) glutathione peroxidase
  • ( PF08534 ) redoxin family protein
  • ( PF00578 ) antioxidant, AhpC/TSA family
  • ( TIGR02540 ) putative glutathione peroxidase Gpx7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00895660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04307.13.999200205084497e-101glutathione peroxidase (176 aa
)
WormBaseWBGene000091655.997418848378574e-45locus:gpx-1 Glutathione pero
xidase 1 status:Partially_co
nfirmed UniProt:O02621 pro
tein_id:CAB03004.1
OxytrichaContig14526.0.g104.001118334825066e-42Glutathione peroxidase
SGDYIR037W1.9993430003514377e-39HYR1 Thiol peroxidase that fun
ctions as a hydroperoxide rece
ptor to sense intracellular hy
droperoxide levels and transdu
ce a redox signal to the Yap1p
transcription factor
Stentor CoeruleusSteCoe_409052.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00895660(coding)
ATGATCAACGGTACTGAATAAATTTAAAGCAATACATCTAGCTTATACGAGCTTTCTGCT
ATAGACATCAATGGTTAAAACGTCTCATTGAAGAACTTTAACAATAAAAAGGCTATTATT
GTTGTAAATGTAGCTTGTAAATGTGGTCTTACTTCTGGTCACTATACTTAGCTTGTTGAA
TTGTATAAATAGTATAAATCTTAAGGATTAGAAGTCTTAGCTTTCCCCTGTAATTAATTT
GGTGAATAAGAACCTTGGGCTGAATCTGAAATTCTTTCATACACTCAAAAGACCTTTAAT
GTTGACTTCCCACTTTTCTCAAAGATCGATGTGAATGGTGAAAACACTCATCCTGTTTAC
AAATATTTAAGAAGAAACTCAGAACTATTTTAGAACAATTCTGCAACTAAGATCCCATGG
AATTTTGCAAAATTCTTGATTGATGGAAAGACTGGCAAAGTTATTTCTTACTTCAGTCCT
AAGGTTAATCCAAACGAAATGGAGCAATAAATTAAATAACTTTTATAATGA


>TTHERM_00895660(protein)
MINGTEQIQSNTSSLYELSAIDINGQNVSLKNFNNKKAIIVVNVACKCGLTSGHYTQLVE
LYKQYKSQGLEVLAFPCNQFGEQEPWAESEILSYTQKTFNVDFPLFSKIDVNGENTHPVY
KYLRRNSELFQNNSATKIPWNFAKFLIDGKTGKVISYFSPKVNPNEMEQQIKQLLQ


>TTHERM_00895660(gene)
AATAAAACTACATACATAAAAATAAAAATAAAAAAAAAAATGATCAACGGTACTGAATAA
ATTTAAAGCAATACATCTAGCTTATACGAGCTTTCTGCTATAGACATCAATGGTTAAAAC
GTCTCATTGAAGAACTTTAACAATAAAAAGGCTATTATTGTTGTAAATGTAGCTTGTAAA
TGTGGTCTTACTTCTGGTCACTATACTTAGCTTGTTGAATTGTATAAATAGTATAAATCT
TAAGGATTAGAAGTCTTAGCTTTCCCCTGTAATTAATTTGGTGAATAAGAACCTTGGGCT
GAATCTGAAATTCTTTCATACACTCAAAAGACCTTTAATGTTGACTTCCCACTTTTCTCA
AAGATCGATGTGAATGGTGAAAACACTCATCCTGTTTACAAATATTTAAGAAGAAACTCA
GAACTATTTTAGAACAATTCTGCAACTAAGATCCCATGGAATTTTGCAAAATTCTTGATT
GATGGAAAGACTGGCAAAGTTATTTCTTACTTCAGTCCTAAGGTTAATCCAAACGAAATG
GAGCAATAAATTAAATAACTTTTATAATGA