Identifiers and Description

Gene Model Identifier

TTHERM_00661720

Standard Name

GPX11 (Glutathione PeroXidase)

Aliases

PreTt23817 | 98.m00160 | 3736.m00060

Description

Glutathione peroxidase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00255 ) glutathione peroxidase
  • ( TIGR02540 ) putative glutathione peroxidase Gpx7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_00661720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17207.11.999745369828301e-106glutathione peroxidase (185 aa
)
OxytrichaContig15497.0.g444.001630327199692e-20Glutathione peroxidase
WormBaseWBGene000091659.99946582325553e-18locus:gpx-1 Glutathione pero
xidase 1 status:Partially_co
nfirmed UniProt:O02621 pro
tein_id:CAB03004.1
SGDYIR037W9.001232279470736e-16HYR1 Thiol peroxidase that fun
ctions as a hydroperoxide rece
ptor to sense intracellular hy
droperoxide levels and transdu
ce a redox signal to the Yap1p
transcription factor

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00661720(coding)
ATGGGAAATAGTGGTCTGAGAAAGCTTTTGTTTGCAGGAGACATCGTCGAATCTCCTTAC
AGAAGCTTAAGCGATATTAAAGTTATTAATTTAGATAAGGAAGAAGTATTTTTAGGAGAT
TTGACTGCTAATAAATATGCAATAGTAGTAAATACTGGATCTCAAAATCCAAATTTTAAA
TAGTAAATCAATGAGCTCAATTAGTTTAAATAAGAAAACAAAGATAAATTAGAAATTTTG
GCATTCCCTTGTAATTAGTTCTATAATGAACCTTCAAACTTCAAAACTATTAAAGATTCA
TATTCTAGCCTTGTATAATTTCCAGTTTTTTAGAAGGTAGAGGTAAATGGTTCATACATG
CATCCTCTCTACAAATTCTTGAAGAGACATTCTTCTCTCTATAATTATAAATTATTAAAT
GGAGCAAAAATAACTGAAGATTTTTCCAAATTTCTTATCAACACAAAAGGAGAAGTAGTT
TCATTTTACGCCGCTTCAACTCCATTGAGTTAGATTTAAAAAGACTTAGATACACTTAAG
GCCACTTAAAATTGA


>TTHERM_00661720(protein)
MGNSGLRKLLFAGDIVESPYRSLSDIKVINLDKEEVFLGDLTANKYAIVVNTGSQNPNFK
QQINELNQFKQENKDKLEILAFPCNQFYNEPSNFKTIKDSYSSLVQFPVFQKVEVNGSYM
HPLYKFLKRHSSLYNYKLLNGAKITEDFSKFLINTKGEVVSFYAASTPLSQIQKDLDTLK
ATQN


>TTHERM_00661720(gene)
ATGGGAAATAGTGGTCTGAGAAAGCTTTTGTTTGCAGGAGACATCGTCGAATCTCCTTAC
AGAAGCTTAAGCGATATTAAAGTTATTAATTTAGATAAGGAAGAAGTATTTTTAGGAGAT
TTGACTGCTAATAAATATGCAATAGTAGTAAATACTGGATCTCAAAATCCAAATTTTAAA
TAGTAAATCAATGAGCTCAATTAGTTTAAATAAGAAAACAAAGATAAATTAGAAATTTTG
GCATTCCCTTGTAATTAGTTCTATAATGAACCTTCAAACTTCAAAACTATTAAAGATTCA
TATTCTAGCCTTGTATAATTTCCAGTTTTTTAGAAGGTAGAGGTAAATGGTTCATACATG
CATCCTCTCTACAAATTCTTGAAGAGACATTCTTCTCTCTATAATTATAAATTATTAAAT
GGAGCAAAAATAACTGAAGATTTTTCCAAATTTCTTATCAACACAAAAGGAGAAGTAGTT
TCATTTTACGCCGCTTCAACTCCATTGAGTTAGATTTAAAAAGACTTAGATACACTTAAG
GCCACTTAAAATTGA