Identifiers and Description

Gene Model Identifier

TTHERM_000141169

Standard Name

GPX10 (Glutatione PeroXidase)

Aliases

None

Description

predicted protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_000141169

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000141169(coding)
ATGGGTTCTCTCCTTTACAAATCAGTTGCTAAAACTGGTGTTGAAAAACTTACGCCTAAA
ACAAATAACTTTTGGGCACTAGAAGCTATTGACATTGATGGAAATCTACGTAAAATGTCA
GAGTTTTAAAATAGAAAAGCAATAATTGTTGTTAATGTTGCATGTAAATGAGGTTTAACA
TCTGACCACTACACTTAGTTAGTGGAAATGTATAAGAAATACAAATCGAGAGGTTTGGAA
ATTCTTGCATTCCCTTCCAATTAATTTATGGGATAGGAGCCTTGGGATCCACCTTAAATT
AAAGAGTTTGTGGTAACTAAATTTGGCGTAGATTTTGTTCTCTTTGGTAAAGTAAATGTT
AACGGAGAAGATTGCCATGAAATCTACAAATACTTGAGAAATAACAGTCCTCTTCACGAT
CCAAAAACTGGAAATTCTAAATAAATTCCATGGAATTTCGCTAAGTTTTTGATTTAAAGT
GATGGTACAGTTCATAGTTTTTACGGACCTAAAACTGAACCAAAAGAAATTGAACCTGTA
TTAGAAAAACTACTTTGA


>TTHERM_000141169(protein)
WVLSFTNQLLKLVLKNLRLKQITFGHQKLLTLMEIYVKCQSFKIEKQQLLLMLHVNEVQH
LTTTLSQWKCIRNTNREVWKFLHSLPINLWDRSLGIHLKLKSLWQLNLAQILFSLVKQML
TEKIAMKSTNT


>TTHERM_000141169(gene)
ATGGGTTCTCTCCTTTACAAATCAGTTGCTAAAACTGGTGTTGAAAAACTTACGCCTAAA
ACAAATAACTTTTGGGCACTAGAAGCTATTGACATTGATGGAAATCTACGTAAAATGTCA
GAGTTTTAAAATAGAAAAGCAATAATTGTTGTTAATGTTGCATGTAAATGAGGTTTAACA
TCTGACCACTACACTTAGTTAGTGGAAATGTATAAGAAATACAAGTAATTTTCATTAAAA
ATTAATAATAGATTTACAAATATTATTTAGTAATTCTAAATTAACCTTTTGATTTAATAT
AGATCGAGAGGTTTGGAAATTCTTGCATTCCCTTCCAATTAATTTATGGGATAGGAGCCT
TGGGATCCACCTTAAATTAAAGAGTTTGTGGTAACTAAATTTGGCGTAGATTTTGTTCTC
TTTGGTAAAGTAAATGTTAACGGAGAAGATTGCCATGAAATCTACAAAGTATTTATTTAT
CGAATTCATTTTAACATAGTTTTTTCAAATTATTTACCATTTTAATTTTTAATTTAGTAC
TTGAGAAATAACAGTCCTCTTCACGATCCAAAAACTGGAAATTCTAAATAAATTCCATGG
AATTTCGCTAAGTTTTTGATTTAAAGTGATGGTACAGTTCATAGTTTTTACGGACCTAAA
ACTGAACCAAAAGAAATTGAACCTGTATTAGAAAAACTACTTTGA