Identifiers and Description

Gene Model Identifier

TTHERM_00630010

Standard Name

GPX1 (Glutathione PeroXidase 1)

Aliases

PreTt06523 | 89.m00117 | 3831.m01418

Description

Glutathione peroxidase family protein; phospholipid hydroperoxide glutathione peroxidase; protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress; induced by glucose starvation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00630010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04307.15.998052087146005e-105glutathione peroxidase (176 aa
)
WormBaseWBGene000110458.000462645699572e-47locus:gpx-2 status:Partially
_confirmed UniProt:U4PB05
protein_id:CDH93042.1
SGDYBR244W1.000403801267624e-40GPX2 Phospholipid hydroperoxid
e glutathione peroxidase induc
ed by glucose starvation that
protects cells from phospholip
id hydroperoxides and nonphosp
holipid peroxides during oxida
tive stress
OxytrichaContig14526.0.g106.000354955737408e-39Glutathione peroxidase
Stentor CoeruleusSteCoe_409057.781132241133797e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000178

Sequences

>TTHERM_00630010(coding)
ATGAACGGTTCAGAACAAATTCAGAGCGAAGCCACAAGCTTATATGATCTTTCAGCCAAT
AACATCAATGGTGAGAATACTCCTTTAAAAAATTTCAATAACAAAAAAGCTATCATCGTT
GTTAATGTTGCTTGCTAGTGTGGTTTAACTTCTGATCATTATACCTAATTAGTCTAATTA
TACAAGCAATATAAATCTTAAGGTTTAGAAATTTTAGGTTTCCCCTGCAACCAATTTGGA
GCATAAGAACCTTGGGCTGAGTCTGAAATCCTTTCATATACTCAAAAGACATTCAACGTA
GAATTCCCTCTTTTCTCTAAGATTGATGTAAATGGAGAAAATACTCATCCTGTTTACAAA
TACTTAAGAAGAAATTCAGAATTATTCTAAAATAATGCTGCAACTAAAATACCTTGGAAT
TTTGCTAAATTTTTAGTTGATGGAAAGACAGGTAAAGTTGTTTAATATTTCAGCCCAAAA
GTTAATCCCGTAGAAATGGAATAGTAAATTAAATAGCTATTACTTTGA


>TTHERM_00630010(protein)
MNGSEQIQSEATSLYDLSANNINGENTPLKNFNNKKAIIVVNVACQCGLTSDHYTQLVQL
YKQYKSQGLEILGFPCNQFGAQEPWAESEILSYTQKTFNVEFPLFSKIDVNGENTHPVYK
YLRRNSELFQNNAATKIPWNFAKFLVDGKTGKVVQYFSPKVNPVEMEQQIKQLLL


>TTHERM_00630010(gene)
ATGAACGGTTCAGAACAAATTCAGAGCGAAGCCACAAGCTTATATGATCTTTCAGCCAAT
AACATCAATGGTGAGAATACTCCTTTAAAAAATTTCAATAACAAAAAAGCTATCATCGTT
GTTAATGTTGCTTGCTAGTGTGGTTTAACTTCTGATCATTATACCTAATTAGTCTAATTA
TACAAGCAATATAAATCTTAAGGTTTAGAAATTTTAGGTTTCCCCTGCAACCAATTTGGA
GCATAAGAACCTTGGGCTGAGTCTGAAATCCTTTCATATACTCAAAAGACATTCAACGTA
GAATTCCCTCTTTTCTCTAAGATTGATGTAAATGGAGAAAATACTCATCCTGTTTACAAA
TACTTAAGAAGAAATTCAGAATTATTCTAAAATAATGCTGCAACTAAAATACCTTGGAAT
TTTGCTAAATTTTTAGTTGATGGAAAGACAGGTAAAGTTGTTTAATATTTCAGCCCAAAA
GTTAATCCCGTAGAAATGGAATAGTAAATTAAATAGCTATTACTTTGA