Identifiers and Description

Gene Model Identifier

TTHERM_00218980

Standard Name

GPP1 (G-Patch Protein 1)

Aliases

PreTt22326 | 18.m00352 | 3701.m00111

Description

G-patch domain containing protein; involved in telomere addition

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00218980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06671.19.997093137033517e-262G-patch domain-containing prot
ein (599 aa)
SGDYLR424W0.0000009995106777214876SPP382 Essential protein that
forms a dimer with Ntr2p; also
forms a trimer, with Ntr2p an
d Prp43p, that is involved in
spliceosome disassembly; found
also in a multisubunit comple
x with the splicing factor Clf
1p; suppressor of prp38-1 muta
tion
OxytrichaContig621.0.g490.000009999254677478949GC-rich sequence DNA-binding f
actor-like protein
WormBaseWBGene000163830.00010003404299092957locus:zgpa-1 status:Confirme
d UniProt:Q18418 protein_i
d:CCD66580.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000040

Sequences

>TTHERM_00218980(coding)
ATGAATACTACTTTAAATAAATACAATAATTTATACCAAAAAATTGTTCAAGGCTCTCAC
CATAATCACATGTTTGATGAAGAGTATTACGCAGATGAAGACATAAGTAATGACATCGCT
CTATAGGCTATTCTACGCAATAAAAAATTATGTGGTCCTGTTCTCTATACCACCACATTT
GGATTTAAAAACAATATTTAATTACAGGGCTAGCAAAGCAAAATATCATAAACATAAAAA
TCTTTCGGGGCTATGTCAAACAAATAATAAAAAAACGGGGCTTTCACATACGATAGTTTA
AAGCAAAAGATCATACTAAAAGATATTATTTCAGATGCAGCTTCGACTATTAAAGCTCCC
GTAGCTACTCGAATTGTAGAGTATAATCTTTAATCTAAATAAATTAAAGATACAAATATT
CATGACTTGATTAATAATTTAGACTACTTTAGTTAGTTTTCCATAAAAGAACTTATTTTG
AATCTTTCATAGAACCCTTTATGCGATAATGGATTCGTCTAGTTAATTAATCACCTCCCT
ATATTCACTACTGCAGAATTAATCACAATTAATCTTGAAAACACTCATATCACAGATCAC
TCTCTACGTTCTCTAAATAGAATCTCTGGACATTTTGAAAATTTAAAAGAAATGTAGTTA
TTGCTCAAAAAGACTTTAATCACAGAGAAATAATCATTCACTCTTGTTGATACTTTTAAC
AATAATGGAATCGATCTAGAAGTTAGTTGTGATTTTGATAAAGTCAATATTTACTCATCT
GAAGTTTCACAAAACGCTAAGCAAGGTGTAGAAATGACTTAATCCAATATTAGCAACTCT
TCAAATGTAAGCAATTTAAGTAGAGCAAACTCAAAGCTTCAATCTAAAATAAATGACAAA
ATTACTACTTAAGTATTTAGTACTGGATCTTTTTCTTAAACTAATATAGGATCTTCAGAA
ATGAATACCAATTCCTTCCAATAAAATTTCAATAAATCTTCTCTAGGCAGTAACTTAGGT
ATGTCATCAAGTTAAATAAGCTAATCTCTACAAGAAGAAGACGTTAAACGTAAAAGTCCA
GAAGAATTAGCTGCAGAGAAGAACTATGAAGATGGGTATGGAAAAGGTTTTAAAATTCTT
ATGGGATTAGGATATAAAGTGGGTAAAGGTCTAGGAAAAAATGATTAAGGCATAACAGAG
CCAGTTTAACCATAAAATAAAAGCAAATTTAAAGAGAATAATCAAAGTAAAGCAAGTATG
GACTACTTTGAATCATTATCAAATAAAACTCAATCTTAGCAAGGTTTATCTAAAATGGTT
AAATTTGAAAAGAAATCTACTCTAATAATCAACTAAAAACCTACTGATTAAGATACAGAA
GATGACAATACATCACCATCGACATCTAGTAATTCAAAAATAGAGTAAATGGAGCTCTAA
AAAACTTCATCCTAGTCAAAGGGCTCTGCAAATATAAAACAAAATAATAATCTCTCTCCA
TTTAATCAATATTAAGGAATTAACATGTATGGAAATCCAAATCAATAATAGCTTTTGCAT
TAAAACATTTCAACAAGCCCATTTATTGGAAATAATTAATAACCATAACAACAACTTCTC
ATGAGTTAGTAGTAGTAATAATAATAAATGCATAATTAAATGTAAATGCATCAATAATAA
ACACCCTTAAATTAATATGTAGCAATGTAGCTTCATCCATCAAGGATGATGTGA


>TTHERM_00218980(protein)
MNTTLNKYNNLYQKIVQGSHHNHMFDEEYYADEDISNDIALQAILRNKKLCGPVLYTTTF
GFKNNIQLQGQQSKISQTQKSFGAMSNKQQKNGAFTYDSLKQKIILKDIISDAASTIKAP
VATRIVEYNLQSKQIKDTNIHDLINNLDYFSQFSIKELILNLSQNPLCDNGFVQLINHLP
IFTTAELITINLENTHITDHSLRSLNRISGHFENLKEMQLLLKKTLITEKQSFTLVDTFN
NNGIDLEVSCDFDKVNIYSSEVSQNAKQGVEMTQSNISNSSNVSNLSRANSKLQSKINDK
ITTQVFSTGSFSQTNIGSSEMNTNSFQQNFNKSSLGSNLGMSSSQISQSLQEEDVKRKSP
EELAAEKNYEDGYGKGFKILMGLGYKVGKGLGKNDQGITEPVQPQNKSKFKENNQSKASM
DYFESLSNKTQSQQGLSKMVKFEKKSTLIINQKPTDQDTEDDNTSPSTSSNSKIEQMELQ
KTSSQSKGSANIKQNNNLSPFNQYQGINMYGNPNQQQLLHQNISTSPFIGNNQQPQQQLL
MSQQQQQQQMHNQMQMHQQQTPLNQYVAMQLHPSRMM


>TTHERM_00218980(gene)
ATGAATACTACTTTAAATAAATACAATAATTTATACCAAAAAATTGTTCAAGGCTCTCAC
CATAATCACATGTTTGATGAAGAGTATTACGCAGATGAAGACATAAGTAATGACATCGCT
CTATAGGCTATTCTACGCAATAAAAAATTATGTGGTCCTGTTCTCTATACCACCACATTT
GGATTTAAAAACAATATTTAATTACAGGGCTAGCAAAGCAAAATATCATAAACATAAAAA
TCTTTCGGGGCTATGTCAAACAAATAATAAAAAAACGGGGCTTTCACATACGATAGTTTA
AAGCAAAAGATCATACTAAAAGATATTATTTCAGATGCAGCTTCGACTATTAAAGCTCCC
GTAGCTACTCGAATTGTAGAGTATAATCTTTAATCTAAATAAATTAAAGATACAAATATT
CATGACTTGATTAATAATTTAGACTACTTTAGTTAGTTTTCCATAAAAGAACTTATTTTG
AATCTTTCATAGAACCCTTTATGCGATAATGGATTCGTCTAGTTAATTAATCACCTCCCT
ATATTCACTACTGCAGAATTAATCACAATTAATCTTGAAAACACTCATATCACAGATCAC
TCTCTACGTTCTCTAAATAGAATCTCTGGACATTTTGAAAATTTAAAAGAAATGTAGTTA
TTGCTCAAAAAGACTTTAATCACAGAGAAATAATCATTCACTCTTGTTGATACTTTTAAC
AATAATGGAATCGATCTAGAAGTTAGTTGTGATTTTGATAAAGTCAATATTTACTCATCT
GAAGTTTCACAAAACGCTAAGCAAGGTGTAGAAATGACTTAATCCAATATTAGCAACTCT
TCAAATGTAAGCAATTTAAGTAGAGCAAACTCAAAGCTTCAATCTAAAATAAATGACAAA
ATTACTACTTAAGTATTTAGTACTGGATCTTTTTCTTAAACTAATATAGGATCTTCAGAA
ATGAATGTATAACCCTTTTCATCTTACTACGGTAATATGACTTTACAATAATAATAATCT
TTATAATAATAGACCAATTCCTTCCAATAAAATTTCAATAAATCTTCTCTAGGCAGTAAC
TTAGGTATGTCATCAAGTTAAATAAGCTAATCTCTACAAGAAGAAGACGTTAAACGTAAA
AGTCCAGAAGAATTAGCTGCAGAGAAGAACTATGAAGATGGGTATGGAAAAGGTTTTAAA
ATTCTTATGGGATTAGGATATAAAGTGGGTAAAGGTCTAGGAAAAAATGATTAAGGCATA
ACAGAGCCAGTTTAACCATAAAATAAAAGCAAATTTAAAGAGAATAATCAAAGTAAAGCA
AGTATGGACTACTTTGAATCATTATCAAATAAAACTCAATCTTAGCAAGGTTTATCTAAA
ATGGTTAAATTTGAAAAGAAATCTACTCTAATAATCAACTAAAAACCTACTGATTAAGAT
ACAGAAGATGACAATACATCACCATCGACATCTAGTAATTCAAAAATAGAGTAAATGGAG
CTCTAAAAAACTTCATCCTAGTCAAAGGGCTCTGCAAATATAAAACAAAATAATAATCTC
TCTCCATTTAATCAATATTAAGGAATTAACATGTATGGAAATCCAAATCAATAATAGCTT
TTGCATTAAAACATTTCAACAAGCCCATTTATTGGAAATAATTAATAACCATAACAACAA
CTTCTCATGAGTTAGTAGTAGTAATAATAATAAATGCATAATTAAATGTAAATGCATCAA
TAATAAACACCCTTAAATTAATATGTAGCAATGTAGCTTCATCCATCAAGGATGATGTGA