Identifiers and Description

Gene Model Identifier

TTHERM_00441810

Standard Name

GPN3 (GPN-loop GTPase 3)

Aliases

PreTt05583 | 50.m00152 | 3681.m00011

Description

GPN-loop GTPase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00441810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12520.19.997093137033517e-262hypothetical protein (293 aa)
OxytrichaContig18293.0.g1077.000472351131044e-82Conserved hypothetical ATP bin
ding protein
DictyBaseDDB_G02851971.9993206333383003e-80gpn3 on chromosome: 4 position
2952647 to 2953733
WormBaseWBGene000135504.001371804839974e-78status:Confirmed UniProt:Q9X
W68 protein_id:CAA22102.1
SGDYLR243W4.997593565024277e-70YLR243W Putative protein of un
known function; YLR243W is an
essential gene
Stentor CoeruleusSteCoe_185603.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00441810(coding)
ATGAATTAGGGAGTATTTTACGGTTAAGTTATAGTTGGTCCTGCAGGAAGTGGAAAATCT
ACTTATTGCCATATTATGTAAGATAATGCCAAACTTTTGAAAAGAAATATTATGGTTGTT
AATCTTGACCCTGCTGCAGAACATTTCAAATATAGATGTGATATAGACATTAGAGATTTA
ATTACACTTGATGATGTTATGGAAGAATTCAAATTAGGACCAAATGGTGGCTTAGTTTAC
TGCATGGAGTATTTATTATAAAATATTGACTGGCTTGAAGAACAGTTATGTGATTTAGCT
ACTGATGATTACGTTTTATTTGATTGTCCAGGATAAATTGAATTATATACACATATGGAT
TTGATGAATAAGTTAACACAATCACTTTCAAATCTAGGTTTTAGCGTATGTTCTATGTAT
ATGTTAGACGTTACTTTTATTAGTGATAATAGCAAATTTATTTCAGGTGTGCTATAAGCT
CTTACTGCAATGATTAGCTTAGGTCTCCCACATATTACAGTTTTAACAAAATGTGATATT
ATTTAAGACAAAAAATAAATAGATGAGTATTTAGAATTTTCAGAAGAAATAGATGATATA
GAAATTAAGGATACTTAAAATATGTCAGAATTTGATAAAAAGTATAATAGTTTGACAAGA
ACATTACGTGAAACAATCAAAGATTATAGTTTAGTTGGTATTAGAAAATTAGATGTTAGT
GATGAAGAAACCATTTTAGATTTATTAGCTGAAGCTGATATGTGCTTAAATTATGGAGAA
AATTTAGAGCCAGATGAGAGATTTTATGAATAAGTAGAGGATAACTTACAAAAAGGAAAT
GATGTTTACTTTGATGAAGGGGCAAATGATGATTTTTGA


>TTHERM_00441810(protein)
MNQGVFYGQVIVGPAGSGKSTYCHIMQDNAKLLKRNIMVVNLDPAAEHFKYRCDIDIRDL
ITLDDVMEEFKLGPNGGLVYCMEYLLQNIDWLEEQLCDLATDDYVLFDCPGQIELYTHMD
LMNKLTQSLSNLGFSVCSMYMLDVTFISDNSKFISGVLQALTAMISLGLPHITVLTKCDI
IQDKKQIDEYLEFSEEIDDIEIKDTQNMSEFDKKYNSLTRTLRETIKDYSLVGIRKLDVS
DEETILDLLAEADMCLNYGENLEPDERFYEQVEDNLQKGNDVYFDEGANDDF


>TTHERM_00441810(gene)
ATGAATTAGGGAGTATTTTACGGTTAAGTTATAGTTGGTCCTGCAGGAAGTGGAAAAGTA
ATTTATATTTCAAGTATATTTCGATTTTATATTTATCTAAATGATATAATATTTAAAAGT
CTACTTATTGCCATATTATGTAAGATAATGCCAAACTTTTGAAAAGAAATATTATGGTTG
TTAATCTTGACCCTGCTGCAGAACATTTCAAATATAGATGTGATATAGGTTAATATTATT
TCGTAGTTTTTTAGCATAGATTAATTTGTAATTTAAATTTAGACATTAGAGATTTAATTA
CACTTGATGATGTTATGGAAGAATTCAAATTAGGACCAAATGGTGGCTTAGTTTACTGCA
TGGAGTAATTAAAAGATAAAACAAAATTTAGAATAATCAAATAAAATTATATTATAGGTA
TTTATTATAAAATATTGACTGGCTTGAAGAACAGTTATGTGATTTAGCTACTGATGATTA
CGTTTTATTTGATTGTCCAGGATAAATTGAATTATATACACATATGGATTTGATGAATAA
GTTAACACAATCACTTTCAAATCTAGGTTTTAGCGTATGTTCTATGTATATGTTAGACGT
TACTTTTATTAGTGATAATAGCAAATTTATTTCAGGTGTGCTATAAGCTCTTACTGCAAT
GATTAGCTTAGGTCTCCCACATATTACAGTTTTAACAAAATGTGATATTATTTAAGACAA
AAAATAAATAGATGAGTAAATTAATTATTTTATCTATAAATGTTGGCTTTTACATTTTAA
AATTAACATGCTTTTTTTAATAATAGTTTAAAAAATAGAATTTTAATTTCAACATTTATT
TATTTATTTAAACAGGTATTTAGAATTTTCAGAAGAAATAGATGATATAGAAATTAAGGA
TACTTAAAATATGTCAGAATTTGATAAAAAGTATAATAGTTTGACAAGAACATTACGTGA
AACAATCAAAGATTATAGTTTAGTTGGTATTAGAAAATTAGATGTTAGTGATGAAGAAAC
CATTTTAGATTTATTAGCTGAAGCTGATATGTGCTTAAATGTAAAATTTTTTTAATCTTA
AAAATGTTATGTTATAATTCCATTTTCTATTTACAGTATGGAGAAAATTTAGAGCCAGAT
GAGAGATTTTATGAATAAGTAGAGGATAACTTACAAAAAGGAAATGATGTTTACTTTGAT
GAAGGGGCAAATGATGATTTTTGA