Identifiers and Description

Gene Model Identifier

TTHERM_00821910

Standard Name

GPN2 (GPN-loop GTPase 2)

Aliases

PreTt07750 | 140.m00065 | 3759.m00367

Description

GPN-loop GTPase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00821910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17508.19.997093137033517e-262hypothetical protein (382 aa)
DictyBaseDDB_G02817874.998444157800704e-72gpn2 on chromosome: 3 position
4982225 to 4983345
OxytrichaContig21267.0.g526.000161128365848e-68Conserved hypothetical ATP bin
ding protein
SGDYOR262W2.9992141389250636e-57YOR262W Protein of unknown fun
ction required for establishme
nt of sister chromatid cohesio
n; contains an ATP/GTP binding
site motif; similar to YLR243
W and is highly conserved acro
ss species and homologous to h
uman gene GPN2/ATPBD1B
WormBaseWBGene000150291.9992362000979228e-56status:Partially_confirmed U
niProt:O01426 protein_id:CCD
61318.1
Stentor CoeruleusSteCoe_160536.47023492564546e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00821910(coding)
ATGAGTAAAGATAGCAATTAATAAAAGACTCAAAATCAAGAGTTTAAATTAGAAGATGTT
CCTAATTTGTTGGAATTTTACGGAGCACTTGTAATTGGACCTAGTGGATCTGGAAAAACA
ACCTTATGCACTGGCTTGCAGCAATTTTACAAACTATTAGAAAGAGATCATGCAATTATT
AATTTAGATCCTGCTAATGAAACAATGAAATATTAATATGCTGTAGACATCAAAGATCTT
ATTAATCTAGAAGATGTTATGGAAGAGCTTAATTTAGGACCCAATGGAGGCTTGATTTAT
TGTATGAAATTTATCGAAGATAATATTGACTGGCTAAAAGAAAGAATAGCTAAGCTTAAA
GGAAAATACTTGATATTTGATTTACCAGGATAGATAGAATTGTATATGGCAAGTGATCAT
GTTAAGAATATCATAGAAAAATTAAAAAAGAATGACATCTTTGAAGCTGAATTTACTATT
GTTGAATTGTTTGATAGCACTTATTGCTACGACTATTCAAATTATGTCAGTTTAACATTG
CAAGCTTTAGTATCGTATCTCAATTTAGAAATGCCTCATATAAATGTTTTAAGCAAAATA
GATCTAATGAAGGAGTATGGAAAGCCTAAAATGTCTTTAGATCATTATTTAGATGGCTAC
GGAGTTTCACTTGCATATAAATATGATTCTATTAGTTATAAAAAGAGTTTGAGTAATTTT
GAAAAAAAAAATTATAGATTAGATAGGAGACTAGCTAGACTTATAGATGAATTTAAACTT
ATTTCATTTATTCCTCTTTCGATTGAAAATAAGTTGCTTGTTTCAAGTTTAGTTTATCAG
ATTGATAAGTCTAATGGCTTTTAATACTCAGAATAATATAACTAGGAGAGATTTTAATAA
ATCAGAGCTGATATTGCAGAAACAAGCTAGGTATATTCAGTCAACGAGAGAGTACTATTA
GAAAATGAATTATTTGGGGATTAAGAAAAAAATATAGATTGGGCAAAGGAGTTTTCTAAA
CCTATGTATAAAGAGTAGGAATTGGATGAAAATAAATCTGATGAATAAAACTAAATTTTA
GAAGATGGCGTAAATTAGGATGATAACGATGATGGAAGTTTATATGATGAAGTAGATGAC
GATGATTATTTTTATTGA


>TTHERM_00821910(protein)
MSKDSNQQKTQNQEFKLEDVPNLLEFYGALVIGPSGSGKTTLCTGLQQFYKLLERDHAII
NLDPANETMKYQYAVDIKDLINLEDVMEELNLGPNGGLIYCMKFIEDNIDWLKERIAKLK
GKYLIFDLPGQIELYMASDHVKNIIEKLKKNDIFEAEFTIVELFDSTYCYDYSNYVSLTL
QALVSYLNLEMPHINVLSKIDLMKEYGKPKMSLDHYLDGYGVSLAYKYDSISYKKSLSNF
EKKNYRLDRRLARLIDEFKLISFIPLSIENKLLVSSLVYQIDKSNGFQYSEQYNQERFQQ
IRADIAETSQVYSVNERVLLENELFGDQEKNIDWAKEFSKPMYKEQELDENKSDEQNQIL
EDGVNQDDNDDGSLYDEVDDDDYFY


>TTHERM_00821910(gene)
ATGAGTAAAGATAGCAATTAATAAAAGACTCAAAATCAAGAGTTTAAATTAGAAGATGTT
CCTAATTTGTTGGAATTTTACGGAGCACTTGTAATTGGACCTAGTGGATCTGGAAAAACA
ACCTTATGCACTGGCTTGCAGCAATTTTACAAACTATTAGAAAGAGATCATGCAATTATT
AATTTAGATCCTGCTAATGAAACAATGAAATATTAAGTATAAGAAATTAAATTAGCAAAG
CAAAATTAAATTTAAAATGATATTTTTTAATTGAATAGTATGCTGTAGACATCAAAGATC
TTATTAATCTAGAAGATGTTATGGAAGAGCTTAATTTAGGGTATAGAAATTACATATTTT
ATTATTAGGAACATATTATTAAATTTAAAGCTAATTTGGCTAATTTTTTAAAATTGCAAA
AAAATATTAGACCCAATGGAGGCTTGATTTATTGTATGAAATTTATCGAAGATAATATTG
ACTGGCTAAAAGAAAGAATAGCTAAGCTTAAAGGAAAATACTTGATATTTGATTTACCAG
GTAAAGTAGACATAAATCTACAAAATTATTTATAAAGTCATGCTAAGTAGAAATATAAAA
TTATTTATAATAAACAGGATAGATAGAATTGTATATGGCAAGTGATCATGTTAAGAATAT
CATAGAAAAATTAAAAAAGAATGACATCTTTGAAGCTGAATTTACTATTGTTGAATTGTT
TGATAGCACTTATTGCTACGACTATTCAAATTATGTCAGTTTAACATTGCAAGCTTTAGT
ATCGTATCTCAATTTAGAAATGCCTCATATAAATGTATTTGCTATAATGCTATTTTTAAG
AAAAAAAATTAAGAATTGACTTTAAATAAATAGGTTTTAAGCAAAATAGATCTAATGAAG
GAGTATGGAAAGCCTAAAATGTCTTTAGATCATTATTTAGATGGCTACGGAGTTTCACTT
GCATATAAATATGATTCTATTAGTTATAAAAAGAGTTTGAGTAATTTTGAAAAAAAAAAT
TATAGATTAGATAGGAGACTAGCTAGACTTATAGATGAATTTAAACTTATTTCATTTATT
CCTCTTTCGATTGAAAATAAGTTGCTTGTTTCAAGTTTAGTTTATCAGATTGATAAGTCT
AATGGCTTTTAATACTCAGAATAAGTAAAGTTTATTTATTTTATTGAGATATAACACATT
AATTATTTAAACATACATATATTTAGTATAACTAGGAGAGATTTTAATAAATCAGAGCTG
ATATTGCAGAAACAAGCTAGGTATATTCAGTCAACGAGAGAGTACTATTAGAAAATGAAT
TATTTGGGGATTAAGAAAAAAATATAGATTGGGCAAAGGAGTTTTCTAAACCTATGTATA
AAGAGTAGGAATTGGATGAAAATAAATCTGATGAATAAAACTAAATTTTAGAAGATGGCG
TAAATTAGGATGATAACGATGATGGAAGTTTATATGATGAAGTAGATGACGATGATTATT
TTTATTGA