Identifiers and Description

Gene Model Identifier

TTHERM_00571980

Standard Name

GPM2 (Glycerate PhosphoMutase)

Aliases

PreTt10528 | 76.m00230 | 3810.m02088

Description

phosphoglycerate mutase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00571980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03415.14.0013667688777736e-172phosphoglycerate mutase (256 a
a)
DictyBaseDDB_G02853113.0004885828297914e-109gpmA on chromosome: 4 position
3080971 to 3081817
OxytrichaContig898.1.g804.0019235632881006e-109Histidine phosphatase superfam
ily (branch 1)
SGDYKL152C5.997798783616184e-81GPM1 Tetrameric phosphoglycera
te mutase, mediates the conver
sion of 3-phosphoglycerate to
2-phosphoglycerate during glyc
olysis and the reverse reactio
n during gluconeogenesis
Stentor CoeruleusSteCoe_19899.221146422925876e-47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00571980(coding)
ATGAGTTCAGAAAGTAAATACAAAGTTGTGTTTGTTCGTCACGGTTAGAGCGAATGGAAT
CTTAAAAATATATTTACAGGCTGGCATGATATTCCATTATCAGAGCAAGGTCATCAAGAA
GCTACTCTTGCAGGATAAATTTTAAAATAGAAAGGTTATAGTTTTGATTTAGCAATAACA
AGTGTCCTACAAAGATCTATTTAGACATTCAATCACATAGCAGAAGAATTATAAATTCAT
CATATTCCTATTATAAAATCTTGGAGACTTAATGAAAGACACTATGGCTCTTTACAAGGC
TTAAATAAATCTGAAACAGCTGCATTACATGGAGAAGCCTAAGTCAAAATCTGGAGAAGA
TCATATGACGTGAGACCTCCTGAAATGTCCATAGATCATCCAGATTACCCAGGTAAGGAT
TCAAGATACAAGCATATACCACCCTCAAGCTTACCAAAAGGAGAATGCTTGAAAGATACT
GTAGAAAGAGTACTTCCTTTCTGGACTGATACTATATGTAAAGCAATTATTGAGGGTCAA
AAAGTAATCGTTTCAGCTCATGGAAATTCTCTTAGAGCCATTGTTAAGTATTTAGATAAG
ATGACTGATGAATAAATTATGGAATTAGACATACCTACTGGAGTTCCTTTAGTTTATGAG
CTTGACGAAAATCTTCTCCCAGTTAAGCATTACTATTTGATCTCATAGGAAGAGTTAGAA
AAGAAGATGCAAGAAGTCAAGAATCAAGGAAAAGCTCAATAAAATTGA


>TTHERM_00571980(protein)
MSSESKYKVVFVRHGQSEWNLKNIFTGWHDIPLSEQGHQEATLAGQILKQKGYSFDLAIT
SVLQRSIQTFNHIAEELQIHHIPIIKSWRLNERHYGSLQGLNKSETAALHGEAQVKIWRR
SYDVRPPEMSIDHPDYPGKDSRYKHIPPSSLPKGECLKDTVERVLPFWTDTICKAIIEGQ
KVIVSAHGNSLRAIVKYLDKMTDEQIMELDIPTGVPLVYELDENLLPVKHYYLISQEELE
KKMQEVKNQGKAQQN


>TTHERM_00571980(gene)
ATGAGTTCAGAAAGTAAATACAAAGTTGTGTTTGTTCGTCACGGTTAGAGCGAATGGAAT
CTTAAAAATATATTTACAGGCTGGCATGATATTCCATTATCAGAGCAAGGTCATCAAGAA
GCTACTCTTGCAGGATAAATTTTAAAATAGAAAGGTTATAGTTTTGATTTAGCAATAACA
AGTGTCCTACAAAGATCTATTTAGACATTCAATCACATAGCAGAAGAATTATAAATTCAT
CATATTCCTATTATAAAATCTTGGAGACTTAATGAAAGACACTATGGCTCTTTACAAGGC
TTAAATAAATCTGAAACAGCTGCATTACATGGTAATTAATCTTATTAATTTTTTAAAATG
TATTCATCATTGTAATAATTTTTACAATAGGAGAAGCCTAAGTCAAAATCTGGAGAAGAT
CATATGACGTGAGACCTCCTGAAATGTCCATAGATCATCCAGATTACCCAGGTAAGGATT
CAAGATACAAGCATATACCACCCTCAAGCTTACCAAAAGGAGAAGTAAAAATTATTTTAA
ATTTTTTTTCTGTGTTTTAAACCAAATTATTTAACGAATAAATTAAGTGCTTGAAAGATA
CTGTAGAAAGAGTACTTCCTTTCTGGACTGATACTATATGTAAAGCAATTATTGAGGGTC
AAAAAGTAATCGTTTCAGCTCATGGAAATTCTCTTAGAGCCATTGTTAAGTATTTAGATA
AGATGACTGATGAATGTATTTTATTAAAAATATTTTTTAAATAATTTTTTGCTACTAGAA
CTATTTATTGAATTTATTTATTTTTAAAAGAAATTATGGAATTAGACATACCTACTGGAG
TTCCTTTAGTTTATGAGCTTGACGAAAATCTTCTCCCAGTTAAGCATTACTATTTGAGTA
AGTTAGTACAATACCTATTGAAAAATAAAATTTTTCTTTAAAATAGTCTCATAGGAAGAG
TTAGAAAAGAAGATGCAAGAAGTCAAGAATCAAGGAAAAGCTCAATAAAATTGA