Identifiers and Description

Gene Model Identifier

TTHERM_00571980

Standard Name

GPM2 (Glycerate PhosphoMutase)

Aliases

PreTt10528 | 76.m00230 | 3810.m02088

Description

GPM2 2-3-bisphosphoglycerate-dependent phosphoglycerate mutase; phosphoglycerate mutase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00571980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03415.14.0013667688777736e-172phosphoglycerate mutase (256 a
a)
DictyBaseDDB_G02853113.0004885828297914e-109gpmA on chromosome: 4 position
3080971 to 3081817
OxytrichaContig898.1.g804.0019235632881006e-109Histidine phosphatase superfam
ily (branch 1)
SGDYKL152C5.997798783616184e-81GPM1 Tetrameric phosphoglycera
te mutase, mediates the conver
sion of 3-phosphoglycerate to
2-phosphoglycerate during glyc
olysis and the reverse reactio
n during gluconeogenesis
Stentor CoeruleusSteCoe_19899.221146422925876e-47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00571980(coding)
ATGAGTTCAGAAAGTAAATACAAAGTTGTGTTTGTTCGTCACGGTTAGAGCGAATGGAAT
CTTAAAAATATATTTACAGGCTGGCATGATATTCCATTATCAGAGCAAGGTCATCAAGAA
GCTACTCTTGCAGGATAAATTTTAAAATAGAAAGGTTATAGTTTTGATTTAGCAATAACA
AGTGTCCTACAAAGATCTATTTAGACATTCAATCACATAGCAGAAGAATTATAAATTCAT
CATATTCCTATTATAAAATCTTGGAGACTTAATGAAAGACACTATGGCTCTTTACAAGGC
TTAAATAAATCTGAAACAGCTGCATTACATGGAGAAGCCTAAGTCAAAATCTGGAGAAGA
TCATATGACGTGAGACCTCCTGAAATGTCCATAGATCATCCAGATTACCCAGGTAAGGAT
TCAAGATACAAGCATATACCACCCTCAAGCTTACCAAAAGGAGAATGCTTGAAAGATACT
GTAGAAAGAGTACTTCCTTTCTGGACTGATACTATATGTAAAGCAATTATTGAGGGTCAA
AAAGTAATCGTTTCAGCTCATGGAAATTCTCTTAGAGCCATTGTTAAGTATTTAGATAAG
ATGACTGATGAATAAATTATGGAATTAGACATACCTACTGGAGTTCCTTTAGTTTATGAG
CTTGACGAAAATCTTCTCCCAGTTAAGCATTACTATTTGATCTCATAGGAAGAGTTAGAA
AAGAAGATGCAAGAAGTCAAGAATCAAGGAAAAGCTCAATAAAATTGA


>TTHERM_00571980(protein)
MSSESKYKVVFVRHGQSEWNLKNIFTGWHDIPLSEQGHQEATLAGQILKQKGYSFDLAIT
SVLQRSIQTFNHIAEELQIHHIPIIKSWRLNERHYGSLQGLNKSETAALHGEAQVKIWRR
SYDVRPPEMSIDHPDYPGKDSRYKHIPPSSLPKGECLKDTVERVLPFWTDTICKAIIEGQ
KVIVSAHGNSLRAIVKYLDKMTDEQIMELDIPTGVPLVYELDENLLPVKHYYLISQEELE
KKMQEVKNQGKAQQN


>TTHERM_00571980(gene)
ATGAGTTCAGAAAGTAAATACAAAGTTGTGTTTGTTCGTCACGGTTAGAGCGAATGGAAT
CTTAAAAATATATTTACAGGCTGGCATGATATTCCATTATCAGAGCAAGGTCATCAAGAA
GCTACTCTTGCAGGATAAATTTTAAAATAGAAAGGTTATAGTTTTGATTTAGCAATAACA
AGTGTCCTACAAAGATCTATTTAGACATTCAATCACATAGCAGAAGAATTATAAATTCAT
CATATTCCTATTATAAAATCTTGGAGACTTAATGAAAGACACTATGGCTCTTTACAAGGC
TTAAATAAATCTGAAACAGCTGCATTACATGGTAATTAATCTTATTAATTTTTTAAAATG
TATTCATCATTGTAATAATTTTTACAATAGGAGAAGCCTAAGTCAAAATCTGGAGAAGAT
CATATGACGTGAGACCTCCTGAAATGTCCATAGATCATCCAGATTACCCAGGTAAGGATT
CAAGATACAAGCATATACCACCCTCAAGCTTACCAAAAGGAGAAGTAAAAATTATTTTAA
ATTTTTTTTCTGTGTTTTAAACCAAATTATTTAACGAATAAATTAAGTGCTTGAAAGATA
CTGTAGAAAGAGTACTTCCTTTCTGGACTGATACTATATGTAAAGCAATTATTGAGGGTC
AAAAAGTAATCGTTTCAGCTCATGGAAATTCTCTTAGAGCCATTGTTAAGTATTTAGATA
AGATGACTGATGAATGTATTTTATTAAAAATATTTTTTAAATAATTTTTTGCTACTAGAA
CTATTTATTGAATTTATTTATTTTTAAAAGAAATTATGGAATTAGACATACCTACTGGAG
TTCCTTTAGTTTATGAGCTTGACGAAAATCTTCTCCCAGTTAAGCATTACTATTTGAGTA
AGTTAGTACAATACCTATTGAAAAATAAAATTTTTCTTTAAAATAGTCTCATAGGAAGAG
TTAGAAAAGAAGATGCAAGAAGTCAAGAATCAAGGAAAAGCTCAATAAAATTGA