Identifiers and Description

Gene Model Identifier

TTHERM_00925490

Standard Name

GPCR6 (G-Protein Coupled Receptor)

Aliases

PreTt04357 | 165.m00075 | 3747.m00330

Description

G-protein coupled receptor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.7%

TetraMine Data

TTHERM_00925490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20687.15.998178742922527e-117hypothetical protein (304 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22140501: Lampert TJ, Coleman KD, Hennessey TM (2011) A knockout mutation of a constitutive GPCR in Tetrahymena decreases both G-protein activity and chemoattraction. PloS one 6(11):e28022

Sequences

>TTHERM_00925490(coding)
ATGGGTGAAAAATATGAAACAATTTCTTTATTACTTTGTTCCATTTTATCTTGCACATCA
ACTGGAATTTTGATATTTTATTTTTTCTACTCTTAACAATCTAGGACTTATGCCTTTAAG
TTAGTTTTTTCGATCTTCATATTTGATTTCATACTGAGCTTTGATTACTTATGTCCCTTA
TTATATCTTCTTATTGATTAAAATGCAAAAATTGGAGATGTTGTTTGTAAGATTTAAGGA
TTTGTAAAGCTATTAGCAACAAATGGAATGTTTTTTAGCTCTCTTGTGATTTCTTGGGTG
CTGTATTCATATTTCATAAGAAAAAAATAAATAAAATATAAAAACCCAATAATACACTAC
TCAAAATTTACTATTGCTTTACCTCTTATTATATCCTTAATACCTCTTATAACTGGCAAC
TATGATCATACTGAACCCTTGAAAGATGTGATGTGCTTTTTAATTGTAAAGAGCTATGAT
GAAGGATCTTACGATACTACAGGGATGGTTTTAAAAATAGCATTGTCATTTATACCTTTT
GTTACTACTATATTTCTTGAACTATTTTTTGTACTTAGAATCCTATACTAATTCTACATA
AATAATGATTAGGTATATTTAGTAAATATTAAAAATTTAATTCTATATCCCTCTATATTG
ATTATTTCATGGATTTGGATTATGTTTGAAAGGTTTTATGAGTTAGTTACAGATGGAGAT
TAAATTAATTGGCTAAATTCATTTGACTTACAGCTTGGAGTATTAAATGGATTTTTTAAC
TCAATAGTCTACGGATTTCTCTCAATAAATCTTTGCCATAGTTTAGAAAAATCAGAAATT
AAATTAATTGAATCAGAAAAAACTCCTTATTCTGATTCTATTTCTGGATTTTCGAGTATT
TATGAAGAAGGAGAAACATGTGATAATTGA


>TTHERM_00925490(protein)
MGEKYETISLLLCSILSCTSTGILIFYFFYSQQSRTYAFKLVFSIFIFDFILSFDYLCPL
LYLLIDQNAKIGDVVCKIQGFVKLLATNGMFFSSLVISWVLYSYFIRKKQIKYKNPIIHY
SKFTIALPLIISLIPLITGNYDHTEPLKDVMCFLIVKSYDEGSYDTTGMVLKIALSFIPF
VTTIFLELFFVLRILYQFYINNDQVYLVNIKNLILYPSILIISWIWIMFERFYELVTDGD
QINWLNSFDLQLGVLNGFFNSIVYGFLSINLCHSLEKSEIKLIESEKTPYSDSISGFSSI
YEEGETCDN


>TTHERM_00925490(gene)
ATGGGTGAAAAATATGAAACAATTTCTTTATTACTTTGTTCCATTTTATCTTGCACATCA
ACTGGAATTTTGATATTTTATTTTTTCTACTCTTAACAATCTAGGACTTATGCCTTTAAG
TTAGTTTTTTCGATCTTCATATTTGATTTCATACTGAGCTTTGATTACTTATGTCCCTTA
TTATATCTTCTTATTGATTAAAATGCAAAAATTGGAGATGTTGTTTGTAAGATTTAAGGA
TTTGTAAAGCTATTAGCAACAAATGGAATGTTTTTTAGCTCTCTTGTGATTTCTTGGGTG
CTGTATTCATATTTCATAAGAAAAAAATAAATAAAATATAAAAACCCAATAATACACTAC
TCAAAATTTACTATTGCTTTACCTCTTATTATATCCTTAATACCTCTTATAACTGGCAAC
TATGATCATACTGAACCCTTGAAAGATGTGATGTGCTTTTTAATTGTAAAGAGCTATGAT
GAAGGATCTTACGATACTACAGGGATGGTTTTAAAAATAGCATTGTCATTTATACCTTTT
GTTACTACTATATTTCTTGAACTATTTTTTGTACTTAGAATCCTATACTAATTCTACATA
AATAATGATTAGGTATATTTAGTAAATATTAAAAATTTAATTCTATATCCCTCTATATTG
ATTATTTCATGGATTTGGATTATGTTTGAAAGGTTTTATGAGTTAGTTACAGATGGAGAT
TAAATTAATTGGCTAAATTCATTTGACTTACAGCTTGGAGTATTAAATGGATTTTTTAAC
TCAATAGTCTACGGATTTCTCTCAATAAATCTTTGCCATAGTTTAGAAAAATCAGAAATT
AAATTAATTGAATCAGAAAAAACTCCTTATTCTGATTCTATTTCTGGATTTTCGAGTATT
TATGAAGAAGGAGAAACATGTGATAATTGA