Identifiers and Description

Gene Model Identifier

TTHERM_00655560

Standard Name

GND1 (6-phosphoGlucoNate Dehydrogenase 1)

Aliases

PreTt03654 | 96.m00123

Description

6-phosphogluconate dehydrogenase (decarboxylating); catalyzes an NADPH-regenerating reaction in the pentose phosphate pathway

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • phosphogluconate dehydrogenase (decarboxylating) activity (IEA) | GO:0004616

Biological Process

Domains

  • ( PF02153 ) prephenate dehydrogenase
  • ( TIGR03026 ) nucleotide sugar dehydrogenase
  • ( PF01488 ) Shikimate / quinate 5-dehydrogenase
  • ( TIGR00112 ) pyrroline-5-carboxylate reductase
  • ( TIGR01692 ) 3-hydroxyisobutyrate dehydrogenase
  • ( PF02826 ) erythronate-4-phosphate dehydrogenase
  • ( TIGR01505 ) 2-hydroxy-3-oxopropionate reductase
  • ( PF03807 ) NADP oxidoreductase coenzyme F420-dependent
  • ( PF02737 ) 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
  • ( TIGR00873 ) 6-phosphogluconate dehydrogenase, decarboxylating
  • ( PF07991 ) Acetohydroxy acid isomeroreductase, catalytic domain
  • ( TIGR00872 ) 6-phosphogluconate dehydrogenase (decarboxylating)
  • ( PF03446 ) NAD binding domain of 6-phosphogluconate

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 31.7%

TetraMine Data

TTHERM_00655560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18003.19.997093137033517e-262NAD binding domain-6-phosphogl
uconate dehydrogenase (302 aa)
OxytrichaContig10468.0.g956.000220702367707e-121NAD binding domain of 6-phosph
ogluconate dehydrogenase
Stentor CoeruleusSteCoe_3862.572209372642415e-56
DictyBaseDDB_G02925664.00073564232477e-35hibA on chromosome: 6 position
1891263 to 1892228
WormBaseWBGene000071221.999790113608142e-24Probable 3-hydroxyisobutyrate
dehydrogenase, mitochondrial
status:Confirmed UniProt:Q9
XTI0 protein_id:CAB03798.1
SGDYGR256W0.000000000006001570085597868GND2 6-phosphogluconate dehydr
ogenase (decarboxylating), cat
alyzes an NADPH regenerating r
eaction in the pentose phospha
te pathway; required for growt
h on D-glucono-delta-lactone

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00655560(coding)
ATGGCTTAGTCTGCAATTAAAACTATCGGTTGGATTGGAACTGGTGTTATGGGTAAGTCT
ATGTGCTTACATTTGTTAAACGCTGGTTTCTAGCTAAATGTTTACAATAGAACTGCTAGT
AAGGCTGACGAATTAGTCAGTAAAGGAGCCAAGTTTTTAGCTCCTGAAGATTTAGCTAAA
AATTCTGATGTAGTATTTTTGATGCTTGGTTATCCTCATGATGTCTAATAAATGGTATTA
GGTGAATAAGGAATTTTAAAGCACATGAAAAAAGGTTCCTTATTGATTGACCACACTACA
TCCGCTCCTTCTCTTGCTGTAGAAATTGCAGCCGAAGCATAAAAGTATGGAATCGAAAGT
ATTGATGCCCCAGTTAGTGGAGGTGATATCGGAGCTAGAGAAGCTAGATTAGCAATTATG
TGTGGCGGTTCCCAAGCTGCTTTTGATCTTGCTCTTCCTATTTTATAAAAGTATGGTGCA
AATATCTAATTATTAGGTGGCGCAGGAGCAGGATAACACACCAAAATGACTAATTAAATT
TTATTAGCTAGCAATATGTTAGGTGTTGTTGAAGGCTTACTCTATGCTCATAAGGCTGGA
TTAGATTTAGATTAAGTAATTAATCTTATTAAGACTGGTGCTGCCTCATCTACTGCATGG
CACGTTCTTGGCTCAAGAATGGTTAAGCGTGACTTTGAACCTGGCTTCTATGTAGAGCAT
TTTATTAAGGATATGGATATTGCCTTAGAAGAGGCCAAAAGAGCTAACTTATGTCTCCCT
GGATTAGGCTTAGTAAAGTAATTTTATCATGCCTTAGTTGCATAAGGAGGTGCTCGTAAT
GGAACTTAAGCTATCATTAAAGTTTTAGAATAAATGAACAATGTTTAAATCGGAAAGAAA
TAATGA


>TTHERM_00655560(protein)
MAQSAIKTIGWIGTGVMGKSMCLHLLNAGFQLNVYNRTASKADELVSKGAKFLAPEDLAK
NSDVVFLMLGYPHDVQQMVLGEQGILKHMKKGSLLIDHTTSAPSLAVEIAAEAQKYGIES
IDAPVSGGDIGAREARLAIMCGGSQAAFDLALPILQKYGANIQLLGGAGAGQHTKMTNQI
LLASNMLGVVEGLLYAHKAGLDLDQVINLIKTGAASSTAWHVLGSRMVKRDFEPGFYVEH
FIKDMDIALEEAKRANLCLPGLGLVKQFYHALVAQGGARNGTQAIIKVLEQMNNVQIGKK
Q


>TTHERM_00655560(gene)
ATGGCTTAGTCTGCAATTAAAACTATCGGTTGGATTGGAACTGGTGTTATGGGTAAGTCT
ATGTGCTTACATTTGTTAAACGCTGGTTTCTAGCTAAATGTTTACAATAGAACTGCTAGT
AAGGCTGACGAATTAGTCAGTAAAGGAGCCAAGTTTTTAGCTCCTGAAGATTTAGCTAAA
AATTCTGATGTAGTATTTTTGATGCTTGGTTATCCTCATGATGTCTAATAAATGGTATTA
GGTGAATAAGGAATTTTAAAGCACATGAAAAAAGGTTCCTTATTGATTGACCACACTACA
TCCGCTCCTTCTCTTGCTGTAGAAATTGCAGCCGAAGCATAAAAGTATGGAATCGAAAGT
ATTGATGCCCCAGTTAGTGGAGGTGATATCGGAGCTAGAGAAGCTAGATTAGCAATTATG
TGTGGCGGTTCCCAAGCTGCTTTTGATCTTGCTCTTCCTATTTTATAAAAGTATGGTGCA
AATATCTAATTATTAGGTGGCGCAGGAGCAGGATAACACACCAAAATGACTAATTAAATT
TTATTAGCTAGCAATATGTTAGGTGTTGTTGAAGGCTTACTCTATGCTCATAAGGCTGGA
TTAGATTTAGATTAAGTAATTAATCTTATTAAGACTGGTGCTGCCTCATCTACTGCATGG
CACGTTCTTGGCTCAAGAATGGTTAAGCGTGACTTTGAAGTAAATTCTTTAATAATAAAC
ATTCTAAAATTCTATTAAAATACAAAAAAAATAAGATATATTTTAACAAAGCTATAATTT
ATAAAATATCTTTTTTGATGATAAAAATTTTGTTTTTTAAATCTTTGTTTTTCTTAGTTT
AATTATTTTTATTAAATAATAGCCTGGCTTCTATGTAGAGCATTTTATTAAGGATATGGA
TATTGCCTTAGAAGAGGCCAAAAGAGCTAACTTATGTCTCCCTGGATTAGGCTTAGTAAA
GTAATTTTATCATGCCTTAGTTGCATAAGGAGGTGCTCGTAATGGAACTTAAGCTATCAT
TAAAGTTTTAGAATAAATGAACAATGTTTAAATCGGAAAGAAATAATGA