Identifiers and Description

Gene Model Identifier

TTHERM_01435670

Standard Name

GLC3 (GLC3 Ortholog)

Aliases

PreTt03614 | 388.m00008

Description

Alpha amylase, catalytic domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02456 ) trehalose synthase
  • ( TIGR02104 ) pullulanase, type I
  • ( PF02922 ) Isoamylase N-terminal domain
  • ( TIGR02403 ) alpha,alpha-phosphotrehalase
  • ( PF00128 ) Alpha amylase, catalytic domain
  • ( TIGR01515 ) 1,4-alpha-glucan branching enzyme
  • ( PF02806 ) Alpha amylase, C-terminal all-beta domain
  • ( TIGR02402 ) malto-oligosyltrehalose trehalohydrolase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01435670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_315810
WormBaseWBGene000114099.997093137033517e-262status:Confirmed UniProt:Q22
137 protein_id:CAA84727.1
Tetrahymena borealisEI9_09467.19.997093137033517e-262alpha amylase, catalytic domai
n-containing protein (808 aa)
DictyBaseDDB_G02741059.997093137033517e-262glgB on chromosome: 2 position
4089271 to 4091779
OxytrichaContig22093.0.g319.997093137033517e-262Alpha amylase, C-terminal all-
beta domain
SGDYEL011W9.997093137033517e-262GLC3 Glycogen branching enzyme
, involved in glycogen accumul
ation; green fluorescent prote
in (GFP)-fusion protein locali
zes to the cytoplasm in a punc
tate pattern

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01435670(coding)
ATGAAGCTATCAAAAAATGATCAAAAAGAAACTAACAATTAGTTAGAAGAAAAAAACGAA
ATGTATATTGACGGTGCTGACACAATTGCTAGAAAGGAAGGATCTCGTTCTTATTCCAAA
AAGAAATCTACATTCGCTCCTCATTAGCAAGGCTTTTCCTTGGACTCTTACCCTGAAAAT
ATAGACGAATTTTAGGTTTTCAAGGATGACCCCTACTTGAATGATTTTAAAGAGCATTTC
AGAGTAAGAAATGACGCCTTTAGATAATAGCTCACTCACATCCTCCGTGCTGAAAACTCC
CTCGAGGACTTTGCTAAAGGTTATAAGAGATATGGATTCAATTAAGAAGGAGATAATCTC
GTTTACAGAGAATGGGCTCCAAGTGCAAAGGAAATTTACTTGACAGGAGATTTCAATAGC
TGGAATAGAAAGCAATACCCATTATAAAAAGATGCCTTTGGTAATTGGGAGATATAAATT
CCTTTCAATTCATAAGGAAAGCCAATAATCCCTCATGGATCTCGTATAAAAGCACATGTA
TTAACTGCTAATAATGAATGGGTAGATCGTATTCCAGTGTGGAGCAAACGTGTAATCCAA
GACGAAAATAGCAAGCTTTTTGATGGACAATTTTGGTGGCCTGAGAAAAACTATTAATTT
TAGCATCCTCGTCCTCACAAACACCATGCATTGAGAATCTATGAGACACATATCGGTATG
GCTGGAATTGAACCTCGTGTCCATACTTTTGCTGAATTCACTAGGGATGTTTTACCTCGT
ATTAAAGATCTTGGTTACAACACTATCCAAATTATGGCAGTAGCTGAACATGCCTACTAT
GGATCCTTTGGATATCACGTCACAAATCTCTTCTCCGTTTCTTCACGTTTTGGAACTCCT
GAAGATTTAAAAAATTTAGTTGACACTGCTCATAGCATGGGTATTCATGTTCTTATGGAC
ATTGTTCACTCTCATGCAAGTAAGAATGTCAATGATGGTTTCAATAATTGGGACGGAACT
GATTATCAATACTTCCACGAAGGAGCTAAAGGAAACCATGATTTGTGGGACTCAAAGATT
TACAATTATGGCAAATGGGAAGTGTTAAGATTACTTTTAAGTAATTTGGAATGGTTCATG
ACTGAATACATGTTTGATGGTTTCCGTTTTGATGGTATTACTTCTATGTTATACAAACAC
CATGGTATGGGAGTAGGTTTCAGTGGCGGTTATCATGAATATTTTAATCATGATGCTGAA
ATAGAAACCTTAGTCTACTTAATGTTGGCTAATGAACTTGTTCATGAAATTTATCCTGAT
GCTATTACTATTGCTGAAGATGTTTCTGGCTATCCCACACTTTGCAGAAAAGTTAAAGAA
GGTGGTGTTGGTTTCGATTATAGATTACAAATGGCTGTTCCTGATAAATGGATCAAGCTA
CTTAAAGAAAAGAGAGACGATGACTGGGATATGGAAGATCTTGTATGGACTTTAACAAAC
AGAAGAAGTGACGAAAAATGTATTGTTTATGCTGAAAGTCACGATTAAGCCTTAGTCGGA
GATAAAACTCTTTCCATGTGGCTTTTTGATGCTTAAATTTATGAAAATATGAGCACTCTT
TCTCATGAAACTCTCACAGTAAATAGAGGTATTGCTCTCCATAAGATGATCAGATTAATA
ACAATTGCCCTTGGAGGAGAAGGTTATCTTAACTTTATGGGTAACGAATTTGGTCACCCA
GAATGGATTGATTTCCCCAGATAAGATAATGGCTGGAGCTATCATCATTGTCGTAGAAGA
TGGGACTTAGTAGATGACTAACTTCTCAGATTCAGATTCTTTAATAATTTCGATAGAGAC
ATGATTCATCTTGAAAGTCATTTCAAGTGGTTAAACTCAAGATACAACTATGTCAGCACC
AAAAATCAAGGAGATAAAGTTATTGTTTTTGAGAGAGATAATCTTCTTTTCGTATTTAAC
TTCCATCCTACACAAAGCTTCGAAAATTATAAAATCGGTACCAACATTGCTGAAGATCAT
TTAATTATTATGGATACTGATGAGCCTCATTACGGTGGTCATGATAGAGTTAGAGCTGGA
CATGAAAAGCCTTTCCCTTATATTTAAGAAAACTTTAATGGTAGACCCTATTGCTTAAAC
GTGTATATACCATCAAGATGTGCTATGGTTTTAACATCTGTAAGCTAAGCACATAATTAC
TGGAACTAAAAAAAGTTACTTAATGAAGCCAAAAAGCATCACTGA


>TTHERM_01435670(protein)
MKLSKNDQKETNNQLEEKNEMYIDGADTIARKEGSRSYSKKKSTFAPHQQGFSLDSYPEN
IDEFQVFKDDPYLNDFKEHFRVRNDAFRQQLTHILRAENSLEDFAKGYKRYGFNQEGDNL
VYREWAPSAKEIYLTGDFNSWNRKQYPLQKDAFGNWEIQIPFNSQGKPIIPHGSRIKAHV
LTANNEWVDRIPVWSKRVIQDENSKLFDGQFWWPEKNYQFQHPRPHKHHALRIYETHIGM
AGIEPRVHTFAEFTRDVLPRIKDLGYNTIQIMAVAEHAYYGSFGYHVTNLFSVSSRFGTP
EDLKNLVDTAHSMGIHVLMDIVHSHASKNVNDGFNNWDGTDYQYFHEGAKGNHDLWDSKI
YNYGKWEVLRLLLSNLEWFMTEYMFDGFRFDGITSMLYKHHGMGVGFSGGYHEYFNHDAE
IETLVYLMLANELVHEIYPDAITIAEDVSGYPTLCRKVKEGGVGFDYRLQMAVPDKWIKL
LKEKRDDDWDMEDLVWTLTNRRSDEKCIVYAESHDQALVGDKTLSMWLFDAQIYENMSTL
SHETLTVNRGIALHKMIRLITIALGGEGYLNFMGNEFGHPEWIDFPRQDNGWSYHHCRRR
WDLVDDQLLRFRFFNNFDRDMIHLESHFKWLNSRYNYVSTKNQGDKVIVFERDNLLFVFN
FHPTQSFENYKIGTNIAEDHLIIMDTDEPHYGGHDRVRAGHEKPFPYIQENFNGRPYCLN
VYIPSRCAMVLTSVSQAHNYWNQKKLLNEAKKHH


>TTHERM_01435670(gene)
ATGAAGCTATCAAAAAAGTAATATTTAATTTACATCCAAAATTTATTATAAAAAAATAAA
TAAATAAATAATAACTCAAAAGTGATCAAAAAGAAACTAACAATTAGTTAGAAGAAAAAA
ACGAAATGTATATTGACGGTGCTGACACAATTGCTAGAAAGGAAGGATCTCGTTCTTATT
CCAAAAAGAAATCTACATTCGCTCCTCATTAGCAAGGCTTTTCCTTGGACTCTTACCCTG
AAAATATAGACGAATTTTAGGTTTTCAAGGATGACCCCTACTTGAATGATTTTAAAGAGC
ATTTCAGAGTAAGAAATGACGCCTTTAGATAATAGCTCACTCACATCCTCCGTGCTGAAA
ACTCCCTCGAGGACTTTGCTAAAGGTATTTTATTATCATTTTTTCTAGATAAATAGCTAT
TTTTATTTTAGTTTGGCATCATTCAAGCAAGTTATTTTTAAATTTTACTTACATATTTTG
AGATGCATTTTACCATTTAGATCATCAATTAAAAAATGAAAAATATTAAATAATTTTGCG
ATAAATTATTTAAAATGAATTTTTGCTTTAAAAAGTAAAAAGAGCAACTTTCAGTTTTTA
AGAAGATTTAAATTATTTTTTATTTTGCTAGCATGAAAGCATAGCGATTTCAATTTGATT
TTTTTGATTTTAGTAATGTCTTTGTCAGTTTTAGTGTAAAATCAACTAATAAATAATGAC
TTTATAATAGATCTAGTAACTTTATTTTAATTAGCTGATTAATCTTACTATTAAATTCAA
GCAAATATTTAAGTAAAATAGAGCAAAAATATTAAGTTACATCGACAACAGAAAGCAAAA
TATAAATGGAAAAATTATTCTATTAGCAATTAATTTTTTTATAAAAATGCAATCAACAAA
AAGCTTTTAAAATACTGCCAAAGAAAATTGAAAATAATCTAAACAAAGAATGAAAAATAA
TTTAATTTATTTACTTTTCAATAGGTTATAAGAGATATGGATTCAATTAAGAAGGAGATA
ATCTCGTTTACAGAGAATGGGCTCCAAGTGCAAAGGAAATTTACTTGACAGGAGATTTCA
ATAGCTGGAATAGAAAGCAATACCCATTATAAAAAGATGCCTTTGGTAATTGGGAGATAT
AAATTCCTTTCAATTCATAAGGAAAGCCAATAATCCCTCATGGATCTCGTATAAAAGCAC
ATGTATTAACTGCTAATAATGAATGGGTAGATCGTATTCCAGTGTGGAGCAAACGTGTAA
TCCAAGACGAAAATAGCAAGCTTTTTGATGGACAATTTTGGTGGCCTGAGAAAAACTATT
AATTTTAGCATCCTCGTCCTCACAAACACCATGCATTGAGAATCTATGAGACACATATCG
GTATGGCTGGAATTGAACCTCGTGTCCATACTTTTGCTGAATTCACTAGGGATGTTTTAC
CTCGTATTAAAGATCTTGGTTACAACACTATCCAAATTATGGCAGTAGCTGAACATGCCT
ACTATGGATCCTTTGGATATCACGTCACAAATCTCTTCTCCGTTTCTTCACGTTTTGGAA
CTCCTGAAGATTTAAAAAATTTAGTTGACACTGCTCATAGCATGGGTATTCATGTTCTTA
TGGACATTGTTCACTCGTAACATTTACAACTCATTTTAATCATTACTATAATAGCAAAAA
TTTACATTTTATGTCTCCCTGCAAAAAATCCATTTAGGCTTAAAAAATTTTAAAATAATC
AAAAAAATAGCTAGTGATAGAAGAAAAAAATTAATCTAAAATTAGAATTTAAAACAGAAT
TAGTTTAACTTAACAAATAAATTACTTCAAATAAATAGAATCAAAAAGAATATGAAAAGA
AAAAATAAAAAAACAAGAATTAACAAGAAAATGTTTGTTTTCTTTTCTAAGTGAATTATT
TGAATAAGAACAATAAACAAGGCTTTAGAAATTATTTTAAAGAACATAAAATTCATTTAA
AAATTTGCGATGAATTAATTTAAATTTTGTGAAGTCAGAGTTTTATAAAAAATAGTAATA
TTGACGTCTTAAGTTAGCTAATTTAATGTAAATAGAAATCGAAAGCAAAATTATAATTTC
ATAGAATAAATAATTAATTTTATAAAGTTTAATAAAATTAATTATTTAACTGGTTATTTA
GTATTAAAAAATTTGCTATTATATATAATATAACAAGAGAAATAATAGTAGGTTAGATTT
AAATAATATTATTTTAATATAGTCATGCAAGTAAGAATGTCAATGATGGTTTCAATAATT
GGGACGGAACTGATTATCAATACTTCCACGAAGGAGCTAAAGGAAACCATGATTTGTGGG
ACTCAAAGATTTACAATTATGGCAAATGGGAAGTGTTAAGATTACTTTTAAGTAATTTGG
AATGGTTCATGACTGAATACATGTTTGATGGTTTCCGTTTTGATGGTATTACTTCTATGT
TATACAAACACCATGGTATGGGAGTAGGTTTCAGTGGCGGTTATCATGAATATTTTAATC
ATGATGCTGAAATAGAAACCTTAGTCTACTTAATGTTGGCTAATGAACTTGTTCATGAAA
TTTATCCTGATGCTATTACTATTGCTGAAGATGTTTCTGGCTATCCCACACTTTGCAGAA
AAGTTAAAGAAGGTGGTGTTGGTTTCGATTATAGATTACAAATGGCTGTTCCTGATAAAG
TAAAAAATAATTAATTGAAATTTCTTTTTAAAATTTAATTTGTTTTTTTTAATTAAAAGT
GGATCAAGCTACTTAAAGAAAAGAGAGACGATGACTGGGATATGGAAGATCTTGTATGGA
CTTTAACAAACAGAAGAAGTGACGAAAAATGTATTGTTTATGCTGAAAGTCACGATTAAG
CCTTAGTCGGAGATAAAACTCTTTCCATGTGGCTTTTTGATGCTGTAAATAAATTTGATT
AATAATAAATATATTTTATTCTTTAAATTAAAATAAAAGTAAATTTATGAAAATATGAGC
ACTCTTTCTCATGAAACTCTCACAGTAAATAGAGGTATTGCTCTCCATAAGATGATCAGA
TTAATAACAATTGCCCTTGGAGGAGAAGTATTTTAATTTAACTTTTAACAAATATTTATT
GAAAATATTTCTATTTTCTTAGATAAATTGTTATTTTTTTTCATACTAAAATTGATTTTT
GTAATAAAAAGGGTTATCTTAACTTTATGGGTAACGAATTTGGTCACCCAGAATGGATTG
ATTTCCCCAGATAAGATAATGGCTGGAGCTATCATCATTGTCGTAGAAGATGGGACTTAG
TAGATGACTAACTTCTCAGATTCAGATTCTTTAATGTAAATATTAAAAAAATACTTTATT
TGTTGAATGAAATTTATTTATTAAAAGAATTTCGATAGAGACATGATTCATCTTGAAAGT
CATTTCAAGTGGTTAAACTCAAGATACAACTATGTCAGCACCAAAAATCAAGGAGATAAA
GTTATTGTTTTTGAGAGAGATAATCTTCTTTTCGTATTTAACTTCCATCCTACACAAGTA
AAATTAACAGCTTTATTAATAACAAGTTATTTATTCAAATCTTTTTAAAAATTCATTAGA
GCTTCGAAAATTATAAAATCGGTACCAACATTGCTGAAGATCATTTAATTATTATGGATA
CTGATGAGGTAATTAATTTTCACATTTAAAAAAATATATTTCAATCAATAGCTTTTAATA
ATATATATTTCTATTATTATAATAGCCTCATTACGGTGGTCATGATAGAGTTAGAGCTGG
ACATGAAAAGCCTTTCCCTTATATTTAAGAAAACTTTAATGGTAGACCCTATTGCTTAAA
CGTGTATATACCATCAAGATGTGCTATGGTTTTAACATCTGTAAGCTAAGCACATAATTA
CTGGAACTAAAAAAAGTTACTTAATGAAGCCAAAAAGCATCACTGA