Identifiers and Description

Gene Model Identifier

TTHERM_01276320

Standard Name

GIW1 (Gentleman-In-Waiting 1)

Aliases

PreTt28295 | 304.m00015 | COI1

Description

Twi1p-associated protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01276320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21071.14.998338612125368e-60hypothetical protein (376 aa)

General Information

Paragraph NoGene NameParagraph Text
104GIW1,
TWI1
Giw1p binds to Twi1p complexed with single-stranded, but not double-stranded, scnRNAs and that this interaction selectively promotes the MAC localization of the mature Twi1p-scnRNA complex (Noto et al. 2010).
105GIW1,
COI12,
TWI1
ATP-dependent and ATP-independent activities of Coi12p facilitate scnRNA loading by counteracting the Twi1p-binding protein Giw1p, which is important for sorting scnRNAs to Twi1p (Woehrer et al. 2015).

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  3. Ref:22103557: Mochizuki K (2012) Developmentally programmed, RNA-directed genome rearrangement in Tetrahymena. Development, growth & differentiation 54(1):108-19
  4. Ref:21915788: Kataoka K, Mochizuki K (2011) Programmed DNA elimination in Tetrahymena: a small RNA-mediated genome surveillance mechanism. Advances in experimental medicine and biology 722( ):156-73
  5. Ref:20211138: Noto T, Kurth HM, Kataoka K, Aronica L, DeSouza LV, Siu KW, Pearlman RE, Gorovsky MA, Mochizuki K (2010) The Tetrahymena argonaute-binding protein Giw1p directs a mature argonaute-siRNA complex to the nucleus. Cell 140(5):692-703

Sequences

>TTHERM_01276320(coding)
ATGTAAAGTTTTGTAAATCTTATCTAACTGGAAGAGAACTATAACTTAAGTCTTTTGTCT
TATTCAAACTCTATAAGGTAGTATCTATTAGATAACAAAGTGCACGAAGATAAATACATA
TAGCTCATGAAAGACATCAAAGATTTGTTTTCGTCTCCTACTTTTTTGATGCCAAATTTC
TCTGACAAAAGAAAATAATTTTTCTCATAATTATGCTTAATTGCTTTTGATTTTGCTAAT
AATTAAGTTACTGAATAATAATCTTTGAGTGAATTTAGAAAAAAATTCAAATTTCCTTTT
GTAATAATTGCTATTATTTACACTAAACTTTTAGAGATAAAAGAAGCCTTACCTGAAGAT
TTCTTAACTCTAGTGGATTGTCACTTCAAAAATAAAGGTCCTTAAAGTATATTTGCCTCT
TTGACATTGATTTCTTTATTTTTGAATGAAGTAGATTAATATGAAATAGATTGTGACCAT
ATTGAATCTTCAAATACATTAAGTAGTTGTAGCGAGGCTGCAGAGTCTAATATTCCTAAA
AAGGTCAATATAACTGTAAAGACAGTCTAAAATTTCTTTGATAAATAAGGATTATAGATG
ATAGCATTTCCCTTAAATGTTATCAAAAATATTCACTGTGTAGCACATGATCAATAGAGT
ATTATCCAGCTATTGCTAAAAATAGTTGTGATAATAATTAAAAACATGAGTAACAAAATC
AAATAAGAGTTTTTTTATTTTCATTAGAAGGATTTAAATGTGATTCTTTCATGTTTTATA
GGCTTTTTGTAGTAAAATAACTAGGCTAGAGAAGATCGCGATGTAGCTTTAGCAAATATT
TTTGAATTTTGCGAATTGCTAGCTAAATCTACTTCACCTGCTTAATTATACGTTGCGTTT
AAAGATTTTTTAGTTTATATTTCATAGAATTTTTCATTTGCTAATGATAGTATAGAATAC
TTTGACTTCAATTCTAAGTGTGTGGATTTTTTAGTTTCTATTACTCCATGCTTTATTTAA
TAGTCTGAGAATTTATCTGCATATCCTTTAATAATATAGTTATTGAAGTAATCTGCTAAA
ATAAATCTTGTGAATTTAGAGGATTAGATAGGCTGCTTGCATATATGGAGCCATTATTCT
GACTAGTTCATTCAGGCTTACGATAATAATAATAATTCAATAAAAGCTGAAACAATTAAT
AACTTAGCTATTCTGAATTCTACTTTTATTGAATCTCTACAATTTGATATAGAGCTATTA
TTTAATTTGTAGATAAAAGATCATGATTCTGAAGATGTTAATTAATTTGTGGACCAACTA
TCCCGCTTAGTTATTCATTCTAATCTCATTGATAACCAATTATTTGTAGAAGTAATAAAA
TCTTTGAGTCTACTTTATTAGAAAAATATGCTCCTTTATTATACTTTCCAAAAATGTTTG
ATGAAGTAGTACCTTAATTCTAAAGATACTCTCAGCTAAATTTACTAAGTTTTTGGCAAG
AGTAATGATTTTCTTTAGATTACAGAATTGTTATTTGAATCTTTTAGTTAAGCACAAAAA
TAATTTGCAAATTTAGATCTAAATACCATAGCTGCTATTGAAAAATTTACATAGTTCATG
TCTTAAATAGGTGCAAAGCTGTTTAATACTTAAATATCTCATCTTGAGTAGTCTTAAATT
TTGGGAATATTTCAAAAATATATTTTGAACCCAATTAAAATGTTTAATTTAAATATATTT
TCTTAATTACCTGAAAATTTTATACAGCTTAATGAAGTTTAATTTAGTCAAGTCTGCACA
ATGATGGAGTCAGTTCATTACTTTATTTTCTCTGACAATAAAAGCAATTCAGATTAAGTT
TTTGAGACAGAGGTTGATGTTTCTATGATAAAAAAGATATTGTTATTCAATTAATCAGTT
AACTAAGACATGGCCTACTGGATTAACCCACAATTAAAGAATGAAAGAAAAAAAATAAAA
TAATTCTACCAAAGTACAATTTATTGGGTAATATTTGCTTCAATTAATCTTGAAAATGCT
GCTAACATATTTGAAAGCTATTTCTTTTAGAAAGAGTTCAATATTTGGGTATTGAATTCT
ACTATCAAAAAGCTCAAAGGTAGGATATTACCAAACACATTTCTGCTTTACTTGTGTTAC
TATTTAAAATCCCTCACTGACTCTGATAGTTTTAGCAAAATTGTTTAAAAGAGTGAATAT
GAAGAAAAATTTAGAAAATTAATGGTAAATATTTCTAAATCTGTACCTTCTGAGATATAT
GTAGATTACTCTAAAATTTAGTACTATCTTTAATTATACATTAATGAAGAGTGTTAAATG
TTTAGATTTTAAATATTAAGTGACTAGACAGTCAGCTTACTGACATTAGAAAACAGATTT
TCTCATGTTTATAAAGTATTTATAATATTAGAAGATCTCTTTACAATTGTTTAGAGATTT
CCTAAGTTTTATTATGAAAATACATTTATGGGTCTAAAAAGGAATTTCTTTTTAAATCGT
GTTTTTTGGATTATTGTTAAATGCTTTACAATAGTTCCTAAGTAAGAGCTATTAGAAAAC
TCTCAGATCTATAAAACTATTTCTCTTTACTTAAATCTGGCAATTAGATTTAAAATGGAT
TTTCTTGAGAAAGAAGAAACTTAGTCAGAAAATTCTCACTATTTTAATTTCATTCTAGAG
ATATTAGACCACATGTATTTTACTAATAAAAAAATTGTGCTTGATTTTTGTTAAAAGATA
TTGAATTATTTTGATTAAGATTGCTATAATTAAAACATTATTTAATTAGCTTAATCTAGC
CAAACTTTTTAAAACATCACTCTTTAGCTTTTTACTAATATTTGGGAGTAAATCTTCAAT
TTTTGTTCTAGTAGCAATGAAAAGGCAGAAGAGTTTAAAGAAAAAGATATTAGCTAATCT
ATTGATTTTATTTTAAAATTCTCTAAGTGTTTATAAGGTAACTTGTCAATAATTTAAGAC
CGTATTATGCTTGTTATAAAAGCCCATCCTATTTATAGTTCGAATTCTCAAATTATTTAT
TCCACTATCATAGAAAATTTGGTAATTAAAGAAATAGATGGAGTTAAGGTTCTTTAAAAT
GTTTTTTTAAAATCTATAATTAAAGACTTACAGATTTGGGCTAAATCTATATGTCCTTAG
AGATTACAAAGCTGA


>TTHERM_01276320(protein)
MQSFVNLIQLEENYNLSLLSYSNSIRQYLLDNKVHEDKYIQLMKDIKDLFSSPTFLMPNF
SDKRKQFFSQLCLIAFDFANNQVTEQQSLSEFRKKFKFPFVIIAIIYTKLLEIKEALPED
FLTLVDCHFKNKGPQSIFASLTLISLFLNEVDQYEIDCDHIESSNTLSSCSEAAESNIPK
KVNITVKTVQNFFDKQGLQMIAFPLNVIKNIHCVAHDQQSIIQLLLKIVVIIIKNMSNKI
KQEFFYFHQKDLNVILSCFIGFLQQNNQAREDRDVALANIFEFCELLAKSTSPAQLYVAF
KDFLVYISQNFSFANDSIEYFDFNSKCVDFLVSITPCFIQQSENLSAYPLIIQLLKQSAK
INLVNLEDQIGCLHIWSHYSDQFIQAYDNNNNSIKAETINNLAILNSTFIESLQFDIELL
FNLQIKDHDSEDVNQFVDQLSRLVIHSNLIDNQLFVEVIKSLSLLYQKNMLLYYTFQKCL
MKQYLNSKDTLSQIYQVFGKSNDFLQITELLFESFSQAQKQFANLDLNTIAAIEKFTQFM
SQIGAKLFNTQISHLEQSQILGIFQKYILNPIKMFNLNIFSQLPENFIQLNEVQFSQVCT
MMESVHYFIFSDNKSNSDQVFETEVDVSMIKKILLFNQSVNQDMAYWINPQLKNERKKIK
QFYQSTIYWVIFASINLENAANIFESYFFQKEFNIWVLNSTIKKLKGRILPNTFLLYLCY
YLKSLTDSDSFSKIVQKSEYEEKFRKLMVNISKSVPSEIYVDYSKIQYYLQLYINEECQM
FRFQILSDQTVSLLTLENRFSHVYKVFIILEDLFTIVQRFPKFYYENTFMGLKRNFFLNR
VFWIIVKCFTIVPKQELLENSQIYKTISLYLNLAIRFKMDFLEKEETQSENSHYFNFILE
ILDHMYFTNKKIVLDFCQKILNYFDQDCYNQNIIQLAQSSQTFQNITLQLFTNIWEQIFN
FCSSSNEKAEEFKEKDISQSIDFILKFSKCLQGNLSIIQDRIMLVIKAHPIYSSNSQIIY
STIIENLVIKEIDGVKVLQNVFLKSIIKDLQIWAKSICPQRLQS


>TTHERM_01276320(gene)
ATGTAAAGTTTTGTAAATCTTATCTAACTGGAAGAGAACTATAACTTAAGTCTTTTGTCT
TATTCAAACTCTATAAGGTAGTATCTATTAGATAACAAAGTGCACGAAGATAAATACATA
TAGCTCATGAAAGACATCAAAGATTTGTTTTCGTCTCCTACTTTTTTGATGCCAAATTTC
TCTGACAAAAGAAAATAATTTTTCTCATAATTATGCTTAATTGCTTTTGATTTTGCTAAT
AATTAAGTTACTGAATAATAATCTTTGAGTGAATTTAGAAAAAAATTCAAATTTCCTTTT
GTAATAATTGCTATTATTTACACTAAACTTTTAGAGATAAAAGAAGCCTTACCTGAAGAT
TTCTTAACTCTAGTGGATTGTCACTTCAAAAATAAAGGTCCTTAAAGTATATTTGCCTCT
TTGACATTGATTTCTTTATTTTTGAATGAAGTAGATTAATATGAAATAGATTGTGACCAT
ATTGAATCTTCAAATACATTAAGTAGTTGTAGCGAGGCTGCAGAGTCTAATATTCCTAAA
AAGGTCAATATAACTGTAAAGACAGTCTAAAATTTCTTTGATAAATAAGGATTATAGATG
ATAGCATTTCCCTTAAATGTTATCAAAAATATTCACTGTGTAGCACATGATCAATAGAGT
ATTATCCAGCTATTGCTAAAAATAGTTGTGATAATAATTAAAAACATGAGTAACAGTATA
GATTTCACTTAAATTTACTTTTAAAATATATTAAATTATTTTTTTAATTAATTTAGAAAT
CAAATAAGAGTTTTTTTATTTTCATTAGAAGGATTTAAATGTGATTCTTTCATGTTTTAT
AGGCTTTTTGTAGTAAAATAACTAGGCTAGAGAAGATCGCGATGTAGCTTTAGCAAATAT
TTTTGAATTTTGCGAATTGCTAGCTAAATCTACTTCACCTGCTTAATTATACGTTGCGTT
TAAAGATTTTTTAGTTTATATTTCATAGAATTTTTCATTTGCTAATGATAGTATAGAATA
CTTTGACTTCAATTCTAAGTGTGTGGATTTTTTAGTTTCTATTACTCCATGCTTTATTTA
ATAGTCTGAGAATTTATCTGCATATCCTTTAATAATATAGTTATTGAAGTAATCTGCTAA
AATAAATCTTGTGAATTTAGAGGATTAGATAGGCTGCTTGCATATATGGAGCCATTATTC
TGACTAGTTCATTCAGGCTTACGATAATAATAATAATTCAATAAAAGCTGAAACAATTAA
TAACTTAGCTATTCTGAATTCTACTTTTATTGAATCTCTACAATTTGATATAGAGCTATT
ATTTAATTTGTAGATAAAAGATCATGATTCTGAAGATGTTAATTAATTTGTGGACCAACT
ATCCCGCTTAGTTATTCATTCTAATCTCATTGATAACCAATTGTAATTTTTTAGTTTACT
TTAAAATATAGTAATGTTTAATTATCTTTTTTGTTTATTTATAAAAATATTAATTAGATT
TGTAGAAGTAATAAAATCTTTGAGTCTACTTTATTAGAAAAATATGCTCCTTTATTATAC
TTTCCAAAAATGTTTGATGAAGTAGTACCTTAATTCTAAAGATACTCTCAGCTAAATTTA
CTAAGTTTTTGGCAAGAGTAATGATTTTCTTTAGATTACAGAATTGTTATTTGAATCTTT
TAGTTAAGCACAAAAATAATTTGCAAATTTAGATCTAAATACCATAGCTGCTATTGAAAA
ATTTACATAGTTCATGTCTTAAATAGGTGCAAAGCTGTTTAATACTTAAATATCTCATCT
TGAGTAGTCTTAAATTTTGGGAATATTTCAAAAATATATTTTGAACCCAATTAAAATGTT
TAATTTAAATATATTTTCTTAATTACCTGAAAATTTTATACAGCTTAATGAAGTTTAATT
TAGTCAAGTCTGCACAATGATGGAGTCAGTTCATTACTTTATTTTCTCTGACAATAAAAG
CAATTCAGATTAAGTAATAACTTTTAAATTAAAAATACTTTTAAAAATTCCTTTTTAAAT
AAAATTTAAAGGTTTTTGAGACAGAGGTTGATGTTTCTATGATAAAAAAGATATTGTTAT
TCAATTAATCAGTTAACTAAGACATGGCCTACTGGATTAACCCACAATTAAAGAATGAAA
GAAAAAAAATAAAATAATTCTACCAAAGTACAATTTATTGGGTAATATTTGCTTCAATTA
ATCTTGAAAATGCTGCTAACATATTTGAAAGCTATTTCTTTTAGAAAGAGTTCAATATTT
GGGTATTGAATTCTACTATCAAAAAGCTCAAAGGTAGGATATTACCAAACACATTTCTGC
TTTACTTGTGTTACTATTTAAAATCCCTCACTGACTCTGATAGTTTTAGCAAAAGTAAAT
TAATTTTATTCATTTATTTATTTCACAAATTTTTTAGTTGTTTAAAAGAGTGAATATGAA
GAAAAATTTAGAAAATTAATGGTAAATATTTCTAAATCTGTACCTTCTGAGATATATGTA
GATTACTCTAAAATTTAGTACTATCTTTAATTATACATTAATGAAGAGTGTTAAATGTTT
AGATTTTAAATATTAAGTGACTAGACAGTCAGCTTACTGACATTAGAAAACAGATTTTCT
CATGTTTATAAAGTATTTATAATATTAGAAGATCTCTTTACAATTGTTTAGAGATTTCCT
AAGTTTTATTATGAAAATACATTTATGGGTCTAAAAAGGAATTTCTTTTTAAATCGTGTT
TTTTGGATTATTGTTAAATGCTTTACAATAGTTCCTAAGTAAGAGCTATTAGAAAACTCT
CAGATCTATAAAACTATTTCTCTTTACTTAAATCTGGCAATTAGATTTAAAATGGATTTT
CTTGAGAAAGAAGAAACTTAGTCAGAAAATTCTCACTATTTTAATTTCATTCTAGAGGTA
TTTAATTTATTTTAATCTAAATTATTTTTATTTAAATTTATTTTTTAAAAAGATATTAGA
CCACATGTATTTTACTAATAAAAAAATTGTGCTTGATTTTTGTTAAAAGATATTGAATTA
TTTTGATTAAGATTGCTATAATTAAAACATTATTTAATTAGCTTAATCTAGCCAAACTTT
TTAAAACATCACTCTTTAGCTTTTTACTAATATTTGGGAGTAAATCTTCAATTTTTGTTC
TAGTAGCAATGAAAAGGCAGAAGAGTTTAAAGAAAAAGATATTAGCTAATCTATTGATTT
TATTTTAAAATTCTCTAAGTGTTTATAAGGTAACTTGTCAATAATTTAAGACCGTATTAT
GCTTGTTATAAAAGCCCATCCTATTTATAGTTCGAATTCTCAAATTATTTATTCCACTAT
CATAGAAAATTTGGTAATTAAAGAAATAGATGGAGTTAAGGTTCTTTAAAATGTTTTTTT
AAAATCTATAATTAAAGACTTACAGATTTGGGCTAAATCTATATGTCCTTAGAGATTACA
AAGCTGA