Identifiers and Description

Gene Model Identifier

TTHERM_00439250

Standard Name

GIP1 (Granule-biosynthesis Induced Protease)

Aliases

PreTt05482 | 49.m00254 | 3708.m00103

Description

Granule-biosynthesis induced protease; putative cysteine protease; transcription induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02218 ) Repeat in HS1/Cortactin
  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00439250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06987.11.99972299831384e-147papain family cysteine proteas
e containing protein (344 aa)
OxytrichaContig1254.0.g808.003186242472315e-51Papain family cysteine proteas
e
DictyBaseDDB_G02909578.003782782428492e-46cprA on chromosome: 5 position
4812963 to 4814596
WormBaseWBGene000007762.0005131442217614e-40locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_270842.6102790696677047e-23

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00439250(coding)
ATGATACTCAAACATATCATCAATTAAATAAAATATTTACTAGAACGAACGGTAAGCTTT
AAATCTTGGATATTTTAGTCATAAAATTTATAAAAATTATAAAACAAAAAAACTAATAAA
TAAAAAATGAATAAGCTACTTATCTCTGCTTTAATTTGCTTAATGATTGCTACTCCTAGT
GTGTTTTGCTAGGATGTTGAAAATAACATTTCTGAAGACATTAAAGTCTAAGACTTATTA
GCATACAATAAATGGAGATTCAACTATAAGAGAGTCTATCTTAATGAAGAAGAGCAGATC
TACAGATAGATTGTTTTCTTTGAAAATCTTGCTAGTGTTAACAAACACCCTTCTCATAAA
TCCTACAGTAAGGGTTTGAACCAGTTCTCTGATATGACTAAAGAAGAATTCAAACAAAGA
GTTTTGAATAAGAAGATTTCTAAAAAGGCTAGCAGTAATAAGGGTGGTAGAAATTTAGCT
GCTGATCCAGCTGTTTCCAACTTAGTCTTTCCCACCAATAATCTTCCTCTATCTGTTGAT
TGGAGAAAAAGAGGTGTCCTCAATCCTGTAAAAAATTAAGGTACTTGTGGTTCATGCTGG
ACTTTTGCAACTGCTGGCATCCTTGAGTCATTCAACTAAATTAAAAATAAATAGCTTCTT
AAGTTCTCTGAGCAACAACTTGTTGATTGTGTCAGCCTAGCTGGATATGATTCTGATGGT
TGTGATGGTGGTTTTTAAGAAGATGGTGTTAGATATGCAATTGAGTATGGTATTGTTTAA
TCTTACAAATACCCTTATGTTGGATATCAAGGTAGATGCAAAGTCACATCTCCCACTTCT
CGTTCTGTAGGTTTTTACCCTTAAAAGTTCCAACTTGTCAATAAAACTGAAGCTGACTTG
AAAGCTGCTTTAGTTTTCTCCCCTGTTTCAATCTCCGTCAATGCTGATACCTGGAAAGAA
TACTATGGTGGTGTTTTTGATGAATGTGGATATACTACCGAAGAAGATCTCAATCATGCT
GTCATCGCTGTAGGTTATGACCAAGAAGGTAACTGGATTGTTAGAAACAGTTGGTCTGCA
GCTTGGGGTGAAGATGGTTACATAAGATTAGCTCCTGGTAACACTTGTGGTATTTTGCTT
GATGGATTAATAGTTACTTAATGA


>TTHERM_00439250(protein)
MILKHIINQIKYLLERTVSFKSWIFQSQNLQKLQNKKTNKQKMNKLLISALICLMIATPS
VFCQDVENNISEDIKVQDLLAYNKWRFNYKRVYLNEEEQIYRQIVFFENLASVNKHPSHK
SYSKGLNQFSDMTKEEFKQRVLNKKISKKASSNKGGRNLAADPAVSNLVFPTNNLPLSVD
WRKRGVLNPVKNQGTCGSCWTFATAGILESFNQIKNKQLLKFSEQQLVDCVSLAGYDSDG
CDGGFQEDGVRYAIEYGIVQSYKYPYVGYQGRCKVTSPTSRSVGFYPQKFQLVNKTEADL
KAALVFSPVSISVNADTWKEYYGGVFDECGYTTEEDLNHAVIAVGYDQEGNWIVRNSWSA
AWGEDGYIRLAPGNTCGILLDGLIVTQ


>TTHERM_00439250(gene)
ATGATACTCAAACATATCATCAATTAAATAAAATATTTACTAGAACGAACGGTAAGCTTT
AAATCTTGGATATTTTAGTCATAAAATTTATAAAAATTATAAAACAAAAAAACTAATAAA
TAAAAAATGAATAAGCTACTTATCTCTGCTTTAATTTGCTTAATGATTGCTACTCCTAGT
GTGTTTTGCTAGGATGTTGAAAATAACATTTCTGAAGACATTAAAGTCTAAGACTTATTA
GCATACAATAAATGGAGATTCAACTATAAGAGAGTCTATCTTAATGAAGAAGAGCAGATC
TACAGATAGATTGTTTTCTTTGAAAATCTTGCTAGTGTTAACAAACACCCTTCTCATAAA
TCCTACAGTAAGGGTTTGAACCAGTTCTCTGATATGACTAAAGAAGAATTCAAACAAAGA
GTTTTGAATAAGAAGATTTCTAAAAAGGCTAGCAGTAATAAGGGTGGTAGAAATTTAGCT
GCTGATCCAGCTGTTTCCAACTTAGTCTTTCCCACCAATAATCTTCCTCTATCTGTTGAT
TGGAGAAAAAGAGGTGTCCTCAATCCTGTAAAAAATTAAGGTACTTGTGGTTCATGCTGG
ACTTTTGCAACTGCTGGCATCCTTGAGTCATTCAACTAAATTAAAAATAAATAGCTTCTT
AAGTTCTCTGAGCAACAACTTGTTGATTGTGTCAGCCTAGCTGGATATGATTCTGATGGT
TGTGATGGTGGTTTTTAAGAAGATGGTGTTAGATATGCAATTGAGTATGGTATTGTTTAA
TCTTACAAATACCCTTATGTTGGATATCAAGGTAGATGCAAAGTCACATCTCCCACTTCT
CGTTCTGTAGGTTTTTACCCTTAAAAGTTCCAACTTGTCAATAAAACTGAAGCTGACTTG
AAAGCTGCTTTAGTTTTCTCCCCTGTTTCAATCTCCGTCAATGCTGATACCTGGAAAGAA
TACTATGGTGGTGTTTTTGATGAATGTGGATATACTACCGAAGAAGATCTCAATCATGCT
GTCATCGCTGTAGGTTATGACCAAGAAGGTAACTGGATTGTTAGAAACAGTTGGTCTGCA
GCTTGGGGTGAAGATGGTTACATAAGATTAGCTCCTGGTAACACTTGTGGTATTTTGCTT
GATGGATTAATAGTTACTTAATGA