Identifiers and Description

Gene Model Identifier

TTHERM_00569500

Standard Name

GEF1 (Guanine nucleotide Exchange Factor )

Aliases

PreTt10478 | 76.m00180 | SEC7 | 3810.m02041

Description

Guanine nucleotide exchange factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • ARF guanyl-nucleotide exchange factor activity (IEA) | GO:0005086

Biological Process

  • regulation of ARF protein signal transduction (IEA) | GO:0032012

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00569500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03460.19.997093137033517e-262Sec7 domain-containing protein
(2007 aa)
OxytrichaContig10719.0.g529.997093137033517e-262Sec7 domain
WormBaseWBGene000123869.998707956568768e-117locus:agef-1 status:Partiall
y_confirmed UniProt:G5EFH7
protein_id:CAA21704.3
SGDYDR170C3.0011595823640496e-94SEC7 Guanine nucleotide exchan
ge factor (GEF) for ADP ribosy
lation factors involved in pro
liferation of the Golgi, intra
-Golgi transport and ER-to-Gol
gi transport; found in the cyt
oplasm and on Golgi-associated
coated vesicles
Stentor CoeruleusSteCoe_84059.964733010103672e-77
DictyBaseDDB_G02731011.0003503620230312e-57DDB_G0273101 on chromosome: 2
position 2569065 to 2575617

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15717927: Mouratou B, Biou V, Joubert A, Cohen J, Shields DJ, Geldner N, Jürgens G, Melançon P, Cherfils J (2005) The domain architecture of large guanine nucleotide exchange factors for the small GTP-binding protein Arf. BMC genomics 6( ):20

Sequences

>TTHERM_00569500(coding)
ATGTAGTAAATGTAGCAGCCAGAAGAAAATCTATAGCCTATTTAGATATACCAAGATATT
TTGGGTAATTCTTTTGAAAAGATCAAAAAGAATCTTCCTAAAAAATATCTTGGAGTCAAA
GACCTAGTTCAGAAAATGCAAAACCATGTGATGTAAGACCCTGCTCATAAATTGGATGCA
AACAGATATTTCATCATTTATAAACTAGCAATCAATACCAAATAACCAAAGTTGATAGAA
GTTTCTTTAAAAGCAATTCAACAACTAATTAGCTATAATTTCTTGAACGGTAATTGTCCA
GATTACACTTTAGAAGTTAATTTAGAGGAGTTTAAAGATCTCCATGACCCTTTCCCTCTC
AGAGATTAGCTAAATACGAGAAAATTAATATCTACAATAATGGATATGATGGTTTCTCTT
ACGAATGAAAAGGATGAAAATCATTAAATGTTAGTTATTAAGATATTTGTCCTATTAGCA
ACTCACATTCATACAGAAATGCATGGAATTCATATATCAGCTGCTATCCAAACAATCATC
ATATATTACTCTCAAACTAGAAATAGTCAAGTAGAGAAACTTGCTAAATAAGCACTTTAG
CAGATCATAAATTATAATTATTAGAAACTTTCCTTAATAGAAGGAGAAAAAATCAAAAAA
TAGTTGTTTGGTAATGGTTTTTTTATAGGAAATGCATAGCAATTGTAATAGCAAAGAGAA
AGAGGGAGAACAACTTAGGATTAAAGTGTTATTTAAAAAGAAAGATCTCCTTCTCCTAAC
CAAACAAATATGACAAAATAATTAATATCTATTAGAGGTGATACAACTCTAATGCAGCAG
AATCAATTAAATTAAAAAGAGTTATCGCCAATTAACAATATCCTCAAATCATAAGAAGAT
GCTTAAGATGCAGATATGAGTGGATATTTTGATGGTGTAAACAGCTTTTCTAAAAATCAA
AACTTTATGTTTTAAGGAATTAGAAAGAATAATGATAAAAATTAGCCTACTTTTGATACA
ATTTGTCTAGATACTCTCATCAATATAGTAGACGATGTTTGCATTTATGAAGCAAGGAAA
GATGCTATAGTTGAAAAAATTAACCAAGATGAAAATATTCCAAGCGATTAGAAGTAAAAT
TACATATAGGTAGAATTATAAAATATTCCAACAAGAGTTGTGCCTACACAACTTGATCCT
AATGATCCATAATATTATAGAGTACTACCCATTAACTCAGACCAATTAGTAAATGAAAAC
GATTAACCTGCTGGATTATTTGGTTGGTGCTCAAAATGTAGAAATACTGCAAATTATTAT
TGTAAAGATCTTCGTGTACCTGTATGCTCTATTGAGTGCAAAATTAGCTACTAATAAATG
AATGAAGCAGTAAATAAAAGATTCTATGATTATTAAAAGAACTCCAAAATAGCATTTGAA
GATTGTCTATCAATTCTTCAATCTCTTTCATATCTCTTAATAGCTCCTTCAGAATAAGTG
CTAGGTATATCTACATCTTCATTAGAAAATGCTAAAAGTAGTGTAAGACTTAAAGTGATT
ACATTGGAAATGATTTATGCAATTTTCGATTTAAGAGATTCAACTTTTTTTAGAAAAGAG
CAAGCAATAAAAGTTATTAAGGAAAAGCTATTTGATGGAATATTAAAATGTTGTTTAAAC
AATGAAAAGAGCATCTTTTCTCTTTCATTTGGTATTTTCCTGTAGCTTCTTATTTACCAT
AAGGAAGAATTTAAAAATGAAATATCTATATTCATTAATGAAATTTTCTTACAGCTACTT
GAAAGCCCTAACTCTAGTTCAAACCACCGCCATTTAGCTTTATAGGTTCTTAACAAAGCC
TTTTAAAAGACAAGGGTTGTTTTAGATTTTTATGTCAACTATGATTGTTCGTTTAACTAA
GTTTAACTTGTTGATAGAATTGTCTCTATTTTAAGTAAAATCGCAACTGGATTGTATTCA
AGACCAGAATTTTAAATGATGATTTAGCCAAATTAGGAATTGTTACTTAGACAGTATGCT
GTCGAAACATTAGCCCTTATGATGAGATCAATATATGAATATTTTGATAACTACACTTAA
TAATAAGATAGCTAAAACTAGAATTAAATTAATGGATAAAGTAAAAATGATGTGCTTAAT
GGAGGTAAAAATTTAGATGAGACAACAATTATGCAAATAGAGGAAAACAGAGAAATTATA
AAAATAGATTTAAATGACCATTAAAATTAGATCGAAAAAGAACATATAATTAAAATAGAA
ACTCAAAGAGCTATTCAAAAGTTTAATAAAAAGCCAAGTCTAGGTATAAAGCATTTGATT
TAAACAGGTATTATTCAGCCAGATGATGCAGTAGGAATAGCTAAATTTTTAATCGAAAAC
CCTTCAATTAGTAAAGATCAAATTGGTGAATACATAGGTGGACACCATGAGTTGAATATA
AATGTTCTGAGTGAGTTTACTGACCTAATTAACTTTTAAGATCGTAGGATTGATGTTGCT
ATGAGACAATATTTAGAAACTTTTACTTTACCTGGAGAAGCATAAATTGTTGATAGAATT
CTTCAGAAATTCGGTGATAAATTTTAGAGAGATAATCCTTAAACTTTTTAGAGTGCAGGA
GGTGCTTATACTCTTTCTTTCTTGCTTATCATGCTTCAGACAGATATGTACAATCCTTAG
GTAAAAGATAAGATGAAGTTGGAAGATTTTATAAAAATAGCTAAGAATATAGAAGGTGAA
CATTTCGAAACTGACTATTTAACAGAGCTATACAGAAGTATATAAAAAGAGCCTTTAGCT
CTTCACGAAAAAGCAAAGACTGTAAAGAATTTATAAGATTCTATCTCCACTACTATGAGA
AAAAAACAAGACTTGTTCCTTTAAGAGACTTAAAAAATGATCGAGAAAGGAAAAAATTTG
ATTTCTGAGAAAAATAAACTTTCGAGCAAATTTATTAAAGCTAATTCTATGTATTACATA
GGCCCTCTAGTTGAAACAATAGGACCTAAGATTTTAAGTGCTTTTAAGCATGCATTAGAA
AACTGTGATGATGATAAGACAGTCAGATTTTCATTGGAAGGCTTCAATAGCACTATTTTG
CTGAGCTGCCATTTTAATTTAGAATAAGAAAGAAACTCATTTGTAGAAGCTCTTTGCTAA
CAGTCAAACCTCGAAAACTTCCCAAATAGTTTTAAGAAAAAAAATTACTCAGTTATTAAG
CAAGTATTGCATTTATCTTAAAAAATTGGAAACAGTCTGCATCAATCATGGTTGCCGATT
TTAACTTTAATCAGCAAGTTGAATGAAAATAGGCTTATATAAAACGGAGCAGATAAAAGA
CCCAGTGGTAGTGGTAGGAGACCAAGCAGCTTAGTCCTTACTGATTCAGAGTGGAGTCTT
TAGCAAAGCTATGTAGAGAGCGATTACATAGATAGAATATATGCTAAAAGCACACAACTT
GATGGAGAGAGTATTTAAGACTTTATTACTGCTCTTTGTCAAGTTTCTAAAGATGAGCTA
ACTAGTAAAAGTTAAACTCCTCGTATTTTTTCTTTGTAGAAAATAGTAGAAATTGCTGAA
TTAAACATGGATAGAGTTGTTATTGTCTGGAATAGAATATGGGCAATTATTAGAGACCAT
TTTGCAGAGGCTGGATGTCACTAGAACCCTTAGATTGCTATTTTAGCAGTTGATAGTCTG
AAACAGCTCTCATAAAAATTTTTTATTAAGGAAGAGAGATTCAATCAATAATTCTAAAGA
GATTTCTTAAAACCTTTCGAAATTATTTTTTAAAATGTCCCAATCTAAAACTTATTCATT
AAAGATTTTATCCTAGACTGCTTTAAAAATTTTCTTGGAAATAAGACTATATATAAAAAA
ATCAAATCTGGCTGGAGAATTATATTTAATATTCTCGGATTTGCTTTGCTAGAAGAATCT
GACGAGCTCTCTCGCAATGCTTATAACATTATAAAAGGAATTATGGAGGAAAATCTGGAC
ACGATACATGATGTCTTTGTTGATTTGGTGCAATGCCTCAATAAGTTGAGTAAAAAGAGA
TAAGAGGATTTAGCATTAGCCTCTATTGAGCTAGTTTAGAAATGCTTGTACTACTTAGCT
GATAAATCTCATGTAGTTCCTAAGTCAAAATTATCATTTTCTTCCCTTCAATCTTAATCA
TCCGATCCTAATATTAATTCATAAACAGGTGAGCATTCTAATACTCACCAAACTAATAAA
AAATCAAACGAAAGCTACTGGGTTCCTCTACTTGGTGTTTTATCAAACTTATGCGGAGAC
CATAGACCAGAAATTTAAGAAAAAAGTATGGAGTCATTATTCAACATCCTTACAGAATAC
GGTTACACTTTTTCAATAGAATTTTGGAAGATGATATTCTAAGGAGTATTGAGACCCTTA
TTCGATGAAATTTAATTTACCTTCCAAACAAAATCACAAAAGTAATTGAATAACACTCAA
AATAATAGAAAGTTTAACTGGCTCAAATAATCTTGTAATAAGGCATTCCATCATATCACA
AACTTGCTCTTTGATTATTATGATGAATTGCAATCACTTGTGATTGAGTTTATCAAGACT
TATGAAAATTGCATAAACAATACAAATGAATAGCTGATAAAGTAATCTGTAACAGCTGCC
AAAAATACAATCATTTAACTAGGTCCTAAATTTAAATCAGAAGATTGGGATATGATAATT
GGATTTTTTGAAAGAATGATCAGATTAACTACTCCTTAAAAGCTTTTGAGCATTAATTCA
GACGAAAATGGATAAAAGATAGCTTAAGATGTCAAAGGAAAGAGGAAAGAATCTCTCATG
TATTTTTATAATTAAAAAATTAACTTTGATGATGCAAACGCTTAATCAAAAGCATAGCTT
TTACTGATTAAGGTTATCTAAGATGTTATAAATTCCTTTTAAGATAAACTATCTTCAAAT
TAACTTGATAATCTCTGCAACATCCTAGACAAATCCTATCTTTTTGCTATTGAATTTAAC
TCTCAAATATTTTTGAGATACTGCTTATGGAAGACAGGATTTAATCCTGAGTTAAAGCAA
TTACCAGGAATACTAAGATAGGAGAGATAAGCTTAGGCAATGAGTTTGTACATCAAATAT
ACACATTATAGAAAATAAATGAAGTCAGGATCTTGCTTTAATTATAATGACCTAATAGAT
AAATTAGTGGAATACATGACACTCTTCTTAAAAAAGCACAAAGATTTACTTAAGATTATT
GAAAGTGAAAGAGAAAAAAGAAATACAGATGAAAGGAGCTATTATGATAGCTATGAAAGA
TTGGATGTTCCAGATTTAAACGAAGAAACTATCGATCTTGTTGTGCACAAAATAAAACTC
ACCGAAGTAGAGAGAGATGTTAACAATCATCGCACTATGATATCAGAGACCGTTCTTCCT
ATTTTAGAAAAAATTGATTTGTCACATATGAAAGAAAGAGTAAAAGAAATATACTGTATT
CTTATAGATATGACTTAATATAGCTAAAATAGAAGCTTTAGTTAGATGGTTTGCTAGCTT
TGCAAAAATTGTAGTAGATGCTAGAATTTAGATGAAGATCTAGATATCTTTATAAGAAAA
ATATTAAAAAAGCTATTTAAGTTTATTTGCGACAATCCTTTACCTGCTTAAGCTCCAGTA
GCTTAGGTTGTTTTAGAATAAAGTGCTTTGCTAAAATCAGTAAATTAAAATCCTATAATT
ATTGCTAATTAGGAGAATGATAATGATAAACAGTTGAATAACCAATAAATTACTAATTAG
AAATCAATTAATTCAGACTATGTAAAAATAACAAATAGCTCCTCTTCGATACCTGAAGTA
ACAAATGAAATAAATGCTGAAATTGATGAAGTATAAAATGAAAATGACAAATAAAAAGTA
AATATAATAAGGAGTGAGTAACATTATCAAGACGATTCAGATAACTAGCTAAAAATTGAA
AAAAATTTAATTAAATAAGTTGCAGGAGATTATGATGAAGATGATTTAAATGGATCAGGA
AATAAAAATTTAAATTAAAATAATTAAATAAATATTAACAGCAATGATAATAGTAAGTCC
AACAGTGAAAACAATATAGATCAAAACTAGTAAAGCAAATGA


>TTHERM_00569500(protein)
MQQMQQPEENLQPIQIYQDILGNSFEKIKKNLPKKYLGVKDLVQKMQNHVMQDPAHKLDA
NRYFIIYKLAINTKQPKLIEVSLKAIQQLISYNFLNGNCPDYTLEVNLEEFKDLHDPFPL
RDQLNTRKLISTIMDMMVSLTNEKDENHQMLVIKIFVLLATHIHTEMHGIHISAAIQTII
IYYSQTRNSQVEKLAKQALQQIINYNYQKLSLIEGEKIKKQLFGNGFFIGNAQQLQQQRE
RGRTTQDQSVIQKERSPSPNQTNMTKQLISIRGDTTLMQQNQLNQKELSPINNILKSQED
AQDADMSGYFDGVNSFSKNQNFMFQGIRKNNDKNQPTFDTICLDTLINIVDDVCIYEARK
DAIVEKINQDENIPSDQKQNYIQVELQNIPTRVVPTQLDPNDPQYYRVLPINSDQLVNEN
DQPAGLFGWCSKCRNTANYYCKDLRVPVCSIECKISYQQMNEAVNKRFYDYQKNSKIAFE
DCLSILQSLSYLLIAPSEQVLGISTSSLENAKSSVRLKVITLEMIYAIFDLRDSTFFRKE
QAIKVIKEKLFDGILKCCLNNEKSIFSLSFGIFLQLLIYHKEEFKNEISIFINEIFLQLL
ESPNSSSNHRHLALQVLNKAFQKTRVVLDFYVNYDCSFNQVQLVDRIVSILSKIATGLYS
RPEFQMMIQPNQELLLRQYAVETLALMMRSIYEYFDNYTQQQDSQNQNQINGQSKNDVLN
GGKNLDETTIMQIEENREIIKIDLNDHQNQIEKEHIIKIETQRAIQKFNKKPSLGIKHLI
QTGIIQPDDAVGIAKFLIENPSISKDQIGEYIGGHHELNINVLSEFTDLINFQDRRIDVA
MRQYLETFTLPGEAQIVDRILQKFGDKFQRDNPQTFQSAGGAYTLSFLLIMLQTDMYNPQ
VKDKMKLEDFIKIAKNIEGEHFETDYLTELYRSIQKEPLALHEKAKTVKNLQDSISTTMR
KKQDLFLQETQKMIEKGKNLISEKNKLSSKFIKANSMYYIGPLVETIGPKILSAFKHALE
NCDDDKTVRFSLEGFNSTILLSCHFNLEQERNSFVEALCQQSNLENFPNSFKKKNYSVIK
QVLHLSQKIGNSLHQSWLPILTLISKLNENRLIQNGADKRPSGSGRRPSSLVLTDSEWSL
QQSYVESDYIDRIYAKSTQLDGESIQDFITALCQVSKDELTSKSQTPRIFSLQKIVEIAE
LNMDRVVIVWNRIWAIIRDHFAEAGCHQNPQIAILAVDSLKQLSQKFFIKEERFNQQFQR
DFLKPFEIIFQNVPIQNLFIKDFILDCFKNFLGNKTIYKKIKSGWRIIFNILGFALLEES
DELSRNAYNIIKGIMEENLDTIHDVFVDLVQCLNKLSKKRQEDLALASIELVQKCLYYLA
DKSHVVPKSKLSFSSLQSQSSDPNINSQTGEHSNTHQTNKKSNESYWVPLLGVLSNLCGD
HRPEIQEKSMESLFNILTEYGYTFSIEFWKMIFQGVLRPLFDEIQFTFQTKSQKQLNNTQ
NNRKFNWLKQSCNKAFHHITNLLFDYYDELQSLVIEFIKTYENCINNTNEQLIKQSVTAA
KNTIIQLGPKFKSEDWDMIIGFFERMIRLTTPQKLLSINSDENGQKIAQDVKGKRKESLM
YFYNQKINFDDANAQSKAQLLLIKVIQDVINSFQDKLSSNQLDNLCNILDKSYLFAIEFN
SQIFLRYCLWKTGFNPELKQLPGILRQERQAQAMSLYIKYTHYRKQMKSGSCFNYNDLID
KLVEYMTLFLKKHKDLLKIIESEREKRNTDERSYYDSYERLDVPDLNEETIDLVVHKIKL
TEVERDVNNHRTMISETVLPILEKIDLSHMKERVKEIYCILIDMTQYSQNRSFSQMVCQL
CKNCSRCQNLDEDLDIFIRKILKKLFKFICDNPLPAQAPVAQVVLEQSALLKSVNQNPII
IANQENDNDKQLNNQQITNQKSINSDYVKITNSSSSIPEVTNEINAEIDEVQNENDKQKV
NIIRSEQHYQDDSDNQLKIEKNLIKQVAGDYDEDDLNGSGNKNLNQNNQININSNDNSKS
NSENNIDQNQQSK


>TTHERM_00569500(gene)
ATGTAGTAAATGTAGCAGCCAGAAGAAAATCTATAGCCTATTTAGATATACCAAGATATT
TTGGGTAATTCTTTTGAAAAGATCAAAAAGAATCTTCCTAAAAAATATCTTGGAGTCAAA
GACCTAGTTCAGAAAATGCAAAGTAAATAGTTTTTGAGCAATTTGTTGAAAAAATGTAGC
ACTGTGGATGCTTAAAATTATAAATGAGGAAACATAAATTTTGCTCTTAAATGTTTATTA
TTTGAATTAAATTGATATTTTGTAATATAAAAGACCATGTGATGTAAGACCCTGCTCATA
AATTGGATGCAAACAGATATTTCATCATTTATAAACTAGCAATCAATACCAAATAACCAA
AGTTGATAGAAGTTTCTTTAAAAGCAATTCAAGTAGATAAAAACACTCATTTTATTTAAT
CAGCATTAATTATATTTTCTATTTTACCATGTTTAATCTTAGAGTTTAAACAAAAAATAT
CACCAAAAAGTATCTAAATAAGTTTAAGTTAGCTCATATCATTTTCAAAAAATACACTAC
TTATTCGTAATAATTTGAGTAGATGTAAATAATAGTTTGAAGGTGTGTACCTAACTGACT
AACTCAATAAAGCTTATGAAAATATTTTGCAAAAAACAAGTTGATACTTATTAAGTTTAA
TTAGTTGATAAATAAATGATTATTGCAAAACGAAATTGATTTGAAAAACTTAAATAAAAC
AATAGAAAAATCAGAAAATAATATTTCAGATATTTTAATTAAATATAAAACATATTATTT
TATTAAAAGCAACTAATTAGCTATAATTTCTTGAACGGTAATTGTCCAGATTACACTTTA
GAAGTTAATTTAGAGGAGTTTAAAGATCTCCATGACCCTTTCCCTCTCAGAGATTAGCTA
AATACGAGAAAATTAATATCTACAATAATGGATATGATGGTTTCTCTTACGAATGAAAAG
GATGAAAATCATTAAATGTTAGTTATTAAGATATTTGTCCTATTAGCAACTCACATTCAT
ACAGAAATGCATGGAATTCATATATCAGCTGCTATCCAAACAATCATCATATATTACTCT
CGTAATATTTATTTATTTACTTGTAAAAATCTCAGCATATATGCTTGCTTGCTTACTTTC
TTACTTACTTACTTAATTACTATCTAAGTCACTAAAATATTATGACAATATTTTCAAAAC
ATTTACTTCTTTCTAAAATTTTTTCTAATTAATTTTCTCTTTCCCTTTTAATTTTTTCAA
AAAAAATTAATAGTTTTTGAATAGCTTAAAAAGCAAATTATATAAAAAATAAAATAATTT
TTATTAAAAATAGAAACTAGAAATAGTCAAGTAGAGAAACTTGCTAAATAAGCACTTTAG
CAGATCATAAATTATAATTATTAGAAACTTTCCTTAATAGAAGGAGAAAAAATCAAAAAA
TAGTTGTTTGGTAATGGTTTTTTTATAGGAAATGCATAGCAATTGTAATAGCAAAGAGAA
AGAGGGAGAACAACTTAGGATTAAAGTGTTATTTAAAAAGAAAGATCTCCTTCTCCTAAC
CAAACAAATATGACAAAATAATTAATATCTATTAGAGGTGATACAACTCTAATGCAGCAG
AATCAATTAAATTAAAAAGAGTTATCGCCAATTAACAATATCCTCAAATCATAAGAAGAT
GCTTAAGATGCAGATATGAGTGGATATTTTGATGGTGTAAACAGCTTTTCTAAAAATCAA
AACTTTATGTTTTAAGGAATTAGAAAGAATAATGATAAAAATTAGCCTACTTTTGATACA
ATTTGTCTAGATACTCTCATCAATATAGTAGACGATGTTTGCATTTATGAAGCAAGGAAA
GATGCTATAGTTGAAAAAATTAACCAAGATGAAAATATTCCAAGCGATTAGAAGTAAAAT
TACATATAGGTAGAATTATAAAATATTCCAACAAGAGTTGTGCCTACACAACTTGATCCT
AATGATCCATAATATTATAGAGTACTACCCATTAACTCAGACCAATTAGTAAATGAAAAC
GATTAACCTGCTGGATTATTTGGTTGGTGCTCAAAATGTAGAAATACTGCAAATTATTAT
TGTAAAGATCTTCGTGTACCTGTATGCTCTATTGAGTGCAAAATTAGCTACTAATAAATG
AATGAAGCAGTAAATAAAAGATTCTATGATTATTAAAAGAACTCCAAAATAGCATTTGAA
GATTGTCTATCAATTCTTCAATCTCTTTCATATCTCTTAATAGCTCCTTCAGAATAAGTG
TAATTTATTCAATAATTAAATGAATCAATTAATAAATTTTTAATTTACTTTAGAGATAAA
ATAATAAATTTATCCAAATTTTATTTTCACATAAAAATAAATATTTAATTTATTTAAAAG
TTTTTTAAATAATAAATATTTAAATTGAACATAAATTTCTAAATAAATTTCTTAAATTTT
AAGTGAAATTTATATCAAATAAAGGTAAATTTGAATCTAAAATTAAAAAATTTTTTTAAA
GATTCTAATTTTTTAATAAAAAATTAAACTATATAAATTTAATAATATAAAAAAATATTG
GATTTAATTTAAATTTAAATAAATAGGCTAGGTATATCTACATCTTCATTAGAAAATGCT
AAAAGTAGTGTAAGACTTAAAGTGATTACATTGGAAATGATTTATGCAATTTTCGATTTA
AGAGATTCAACTTTTTTTAGAAAAGAGCAAGCAATAAAAGTTATTAAGGAAAAGCTATTT
GATGGAATATTAAAATGTTGTTTAAACAATGAAAAGAGCATCTTTTCTCTTTCATTTGGT
ATTTTCCTGTAGCTTCTTATTTACCATAAGGAAGAATTTAAAAATGAAATATCTATATTC
ATTAATGAAATTTTCTTACAGCTACTTGAAAGCCCTAACTCTAGTTCAAACCACCGCCAT
TTAGCTTTATAGGTTCTTAACAAAGCCTTTTAAAAGACAAGGGTTGTTTTAGATTTTTAT
GTCAACTATGATTGTTCGTTTAACTAAGTTTAACTTGTTGATAGAATTGTCTCTATTTTA
AGTAATTAATTTACTAAACTTACTCTATTTTTATATATAATTTTGTTTTAATTTACTTTA
AATTTAAAAGGTAAAATCGCAACTGGATTGTATTCAAGACCAGAATTTTAAATGATGATT
TAGCCAAATTAGGAATTGTTACTTAGACAGTATGCTGTCGAAACATTAGCCCTTATGATG
AGATCAATATATGAATATTTTGATAACTACACTTAATAATAAGATAGCTAAAACTAGAAT
TAAATTAATGGATAAAGTAAAAATGATGTGCTTAATGGAGGTAAAAATTTAGATGAGACA
ACAATTATGCAAATAGAGGAAAACAGAGAAATTATAAAAATAGATTTAAATGACCATTAA
AATTAGTAAATTAAATAAATTTCAACATTTTTTCTAATCTAAATCATTTATTTTATTTAA
AAAAAGGATCGAAAAAGAACATATAATTAAAATAGAAACTCAAAGAGCTATTCAAAAGTT
TAATAAAAAGCCAAGTCTAGGTATAAAGCATTTGATTTAAACAGGTATTATTCAGCCAGA
TGATGCAGTAGGAATAGCTAAATTTTTAATCGAAAACCCTTCAATTAGTAAAGATCAAAT
TGGTGAATACATAGGTGGACACCATGAGTTGAATATAAATGTTCTGAGTGAGTTTACTGA
CCTAATTAACTTTTAAGATCGTAGGATTGATGTTGCTATGAGACAATATTTAGAAACTTT
TACTTTACCTGGAGAAGTAAGGCTTAAATACACATTTTCATACATATATAAATAAATAAA
TACATTTTTTGTTAAAAGGCATAAATTGTTGATAGAATTCTTCAGAAATTCGGTGATAAA
TTTTAGAGAGATAATCCTTAAACTTTTTAGAGTGCAGGAGGTGCTTATACTCTTTCTTTC
TTGCTTATCATGCTTCAGACAGATATGTACAATCCTTAGGTAAAAGATAAGATGAAGTTG
GAAGATTTTATAAAAATAGCTAAGAATATAGAAGGTGAACATTTCGAAACTGACTATTTA
ACAGAGCTATACAGAAGTATATAAAAAGAGCCTTTAGCTCTTCACGAAAAAGCAAAGACT
GTAAAGAATTTATAAGATTCTATCTCCACTACTATGAGAAAAAAACAAGACTTGTTCCTT
TAAGAGACTTAAAAAATGATCGAGAAAGGAAAAAATTTGATTTCTGAGAAAAATAAACTT
TCGAGCAAATTTATTAAAGCTAATTCTATGTATTACATAGGCCCTCTAGTTGAAACAATA
GGACCTAAGATTTTAAGTGCTTTTAAGCATGCATTAGAAAACTGTGATGATGATAAGACA
GTCAGATTTTCATTGGAAGGCTTCAATAGCACTATTTTGCTGAGCTGCCATTTTAATTTA
GAATAAGAAAGAAACTCATTTGTAGAAGCTCTTTGCTAACAGTCAAACCTCGAAAACTTC
CCAAATAGTTTTAAGAAAAAAAATTACTCAGTTATTAAGCAAGTATTGCATTTATCTTAA
AAAATTGGAAACAGTCTGCATCAATCATGGTTGCCGATTTTAACTTTAATCAGCAAGTAA
AAAAATAAATTGGTCTTTGATTTATATGTTATCATTTTTATTTAATTTTAAAAGGTTGAA
TGAAAATAGGCTTATATAAAACGGAGCAGATAAAAGACCCAGTGGTAGTGGTAGGAGACC
AAGGTAAATTAAATTGATTCAACAATAATTTTTTATTTTTAGATATTTTGATAATTTTTA
TGAATCTCTTTTCTAAAATTATATAGCAGCTTAGTCCTTACTGATTCAGAGTGGAGTCTT
TAGCAAAGCTATGTAGAGAGCGATTACATAGATAGAATATATGCTAAAAGCACACAACTT
GATGGAGAGAGTATTTAAGACTTTATTACTGCTCTTTGTCAAGTTTCTAAAGATGAGCTA
ACTAGTAAAAGTTAAACTCCTCGTATTTTTTCTTTGTAGAAAATAGTAGAAATTGCTGAA
TTAAACATGGATAGAGTTGTTATTGTCTGGAATAGAATATGGGCAATTATTAGAGACCAT
TTTGCAGAGGCTGGATGTCACTAGAACCCTTAGATTGCTATTTTAGCAGTTGATAGTCTG
AAACAGCTCTCATAAAAATTTTTTATTAAGGAAGAGAGATTCAATCAATAATTCTAAAGA
GATTTCTTAAAACCTTTCGAAATTATTTTTTAAAATGTCCCAATCTAAAACTTATTCATT
AAAGATTTTATCCTAGACTGCTTTAAAAATTTTCTTGGAAATAAGACTATATATAAAAAA
ATCAAATCTGGCTGGAGAATTATATTTAATATTCTCGGATTTGCTTTGCTAGAAGAATCT
GACGAGCTCTCTCGCAATGCTTATAACGTATTATTTTATTTGTGTTTTCATTTTAATTCT
AATTTAAAAAAACAAAAGCAATTAATCTAAATTATCTAGATTATAAAAGGAATTATGGAG
GAAAATCTGGACACGATACATGATGTCTTTGTTGATTTGGTGCAATGCCTCAATAAGTTG
AGTAAAAAGAGATAAGAGGATTTAGCATTAGCCTCTATTGAGCTAGTTTAGAAATGCTTG
TACTACTTAGCTGATAAATCTCATGTAGTTCCTAAGTCAAAATTATCATTTTCTTCCCTT
CAATCTTAATCATCCGATCCTAATATTAATTCATAAACAGGTGAGCATTCTAATACTCAC
CAAACTAATAAAAAATCAAACGAAAGTAATTAATTAATAGTTTAAAATATTCTTTTAATT
TTTTCAATTAATTTTTTTTTAGGCTACTGGGTTCCTCTACTTGGTGTTTTATCAAACTTA
TGCGGAGACCATAGACCAGAAATTTAAGAAAAAAGTATGGAGTCATTATTCAACATCCTT
ACAGAATACGGTTACACTTTTTCAATAGAATTTTGGAAGATGATATTCTAAGGAGTATTG
AGACCCTTATTCGATGAAATTTAATTTACCTTCCAAACAAAATCACAAAAGTAATTGAAT
AACACTCAAAATAATAGAAAGTTTAACTGGCTCAAATAATCTTGTAATAAGGCATTCCAT
CATATCACAAACTTGCTCTTTGATTATTATGATGAATTGCAATCACTTGTGATTGAGTTT
ATCAAGACTTATGAAAATTGCATAAACAATACAAATGAATAGCTGATAAAGTAATCTGTA
ACAGCTGCCAAAAATACAATCATTTAACTAGGTCCTAAATTTAAATCAGAAGATTGGGAT
ATGATAATTGGATTTTTTGAAAGAATGATCAGATTAACTACTCCTTAAAAGGTATTGAAT
TATTTACAAACAAGATACCATTTTAATTATTTTTCTTTAAAAATAATAAGCTTTTGAGCA
TTAATTCAGACGAAAATGGATAAAAGATAGCTTAAGATGTCAAAGGAAAGAGGAAAGAAT
CTCTCATGTATTTTTATGTAAAACAAATTATTTTCTTTTTTGGTTGTAAATTAATTTTAT
TTATTTATTTATTTTTTATAAAGAATTAAAAAATTAACTTTGATGATGCAAACGCTTAAT
CAAAAGCATAGCTTTTACTGATTAAGGTTATCTAAGATGTTATAAATTCCTTTTAAGATA
AACTATCTTCAAATTAACTTGATAATCTCTGCAACATCCTAGACAAATCCTATCTTTTTG
CTATTGAATTTAACTCTCAAATATTTTTGAGATACTGCTTATGGAAGACAGGTAATATAT
TTGATTAATTTAAAAAAGAATGAGTAAATAAATTGTTTATTAATTAATTAAAAGGATTTA
ATCCTGAGTTAAAGCAATTACCAGGAATACTAAGATAGGAGAGATAAGCTTAGGCAATGA
GTTTGTACATCAAATATACACATTATAGAAAATAAATGAAGTCAGGATCTTGCTTTAATT
ATAATGACCTAATAGAGTAAGAATATAAAAAAAATTACAATACTAAAAATATTTTATCAT
ATCAAATAGTAAATTAGTGGAATACATGACACTCTTCTTAAAAAAGCACAAAGATTTACT
TAAGATTATTGAAAGTGAAAGAGAAAAAAGAAATACAGATGAAAGGAGCTATTATGATAG
CTATGAAAGATTGGATGTTCCAGATTTAAACGAAGAAACTATCGATCTTGTTGTGCACAA
AATAAAACTCACCGAAGTAGAGAGAGATGTTAACAATCATCGCACTATGATATCAGAGAC
CGTTCTTCCTATTTTAGAAAAAATTGATTTGTCACATGTAAGTTACAACATATTTTACTT
ATTTATTTATGAGTATATAAAATTATTTATTATCAACCAACAGATGAAAGAAAGAGTAAA
AGAAATATACTGTATTCTTATAGATATGACTTAATATAGCTAAAATAGAAGCTTTAGTTA
GATGGTTTGCTAGCTTTGCAAAAATTGTAGTAGATGCTAGAATTTAGATGAAGATCTAGA
TATCTTTATAAGAAAAATATTAAAAAAGCTATTTAAGTTTATTTGCGACAATCCTTTACC
TGCTTAAGCTCCAGTAGCTTAGGTTGTTTTAGAATAAAGTGCTTTGCTAAAATCAGTAAA
TTAAAATCCTATAATTATTGCTAATTAGGAGAATGATAATGATAAACAGTTGAATAACCA
ATAAATTACTAATTAGAAATCAATTAATTCAGACTATGTAAAAATAACAAATAGCTCCTC
TTCGATACCTGAAGTAACAAATGAAATAAATGCTGAAATTGATGAAGTATAAAATGAAAA
TGACAAATAAAAAGTAAATATAATAAGGAGTGAGTAACATTATCAAGACGATTCAGATAA
CTAGCTAAAAATTGAAAAAAATTTAATTAAATAAGTTGCAGGAGATTATGATGAAGATGA
TTTAAATGGATCAGGAAATAAAAATTTAAATTAAAATAATTAAATAAATATTAACAGCAA
TGATAATAGTAAGTCCAACAGTGAAAACAATATAGATCAAAACTAGTAAAGCAAATGA