Identifiers and Description

Gene Model Identifier

TTHERM_00701150

Standard Name

GDP1 (Glycerophosphoryl Diester Phosphodiesterase 1)

Aliases

PreTt14912 | 109.m00130

Description

Glycerophosphoryl diester phosphodiesterase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • glycerophosphodiester phosphodiesterase activity (IEA) | GO:0008889

Biological Process

Domains

  • ( PF03009 ) glycerophosphodiester phosphodiesterase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 91%

TetraMine Data

TTHERM_00701150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16093.19.997093137033517e-262glycosyl transferase, group 1
family protein (771 aa)
OxytrichaContig2747.0.g574.000521932330652e-52Glycerophosphoryl diester phos
phodiesterase family
Stentor CoeruleusSteCoe_183784.248354255291589e-18
DictyBaseDDB_G02713740.000000000040005666873964816DDB_G0271374 on chromosome: 2
position 135005 to 136400
SGDYPL206C0.00000000019994075865167896PGC1 Phosphatidyl Glycerol pho
spholipase C; regulates the ph
osphatidylglycerol (PG) conten
t via a phospholipase C-type d
egradation mechanism; contains
glycerophosphodiester phospho
diesterase motifs
WormBaseWBGene000196120.0000000020002373268528243Putative glycerophosphocholine
phosphodiesterase GPCPD1 homo
log K10B3.6 status:Partially
_confirmed UniProt:Q21407
protein_id:CCD64603.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00701150(coding)
ATGGCAGCTTTAAAAATTTTGTTAGTAGCCATCCTTTTGTGTTCTGGATGTCTTAGTATT
AGTGTAACAAATAATACTACTTGGGACTACACAGTAGCTAAAAATAGACCTTTGGTAATT
GCTCATAGAGGTTATTCTTCTCTTTTCCCAGAAAACACTCTTGAAGCTTTCAGAGCTGCA
ATCTATGCTGGTGCTGATTTCTTTGAGTTAGATGTCCAAGTTACCAAAGATAACGTTCTT
TTAGTTTCTCATGATGCAACTCTTTCTCGTGTTACTGATGTTGCTAATAGAACTGAATTC
AAAAATAAGAAATCAACTAAATTGATTGATGGATAAAATGTCACTGATTGGTTTATTTGT
GACTTCACCCTTGCTGAAGTAAAAACCCTCAAAATTAAATAGGTTTAAGTTTAAGGAAGA
AATCAAGATTTGAACACCTATTTTACTTTCCCAAGCTTAAGAGAAACCATAGAAATGCTT
ATATAATTCAACTAACAACATTAAGGTAAAAGAAATCTTGATAATAGAATTGCAGGAGTA
GTAATTGAATCTAAGGATAGAGATTTTTATCTTAATAATTATCACTTTGAGTAAGGAGCA
AAAATTGTTGATTTACTCAGAGAGTTTAATTTACACACTATGTACAATGCTTCTATTTAT
GCCCCTATTATATTGCACTCTTTTGATGCACCAACAGTCTAATTATGGCATAATATTACT
GACTTACCTAACAGTTAACTTGGAAGAATCAATTCACTTCCTTATTCTCTCCAACAAACT
AGTACATATGCCACTACAGTTGGTTTGGAAATTAGCTCATTCTTTAACAATACTTCCAAG
AAACCCACTGGAGTTGTAGACTAAGTTAAAGCTGCTGGTTTATAAATACACGGTTGGACT
TTCAGAGATGATCAATTGACCTGGGGTAATGACAGTATTGATTAATACGTTATTGCTTGC
CAAACTTTAAATATAACTGGTATTATTTCTGAATTCCCAGAAGCTGCTATCAGTGTCGCT
GTTATGATACGTAGATAAAATGAAAAGATAATAGCTTAAATTTGA


>TTHERM_00701150(protein)
MAALKILLVAILLCSGCLSISVTNNTTWDYTVAKNRPLVIAHRGYSSLFPENTLEAFRAA
IYAGADFFELDVQVTKDNVLLVSHDATLSRVTDVANRTEFKNKKSTKLIDGQNVTDWFIC
DFTLAEVKTLKIKQVQVQGRNQDLNTYFTFPSLRETIEMLIQFNQQHQGKRNLDNRIAGV
VIESKDRDFYLNNYHFEQGAKIVDLLREFNLHTMYNASIYAPIILHSFDAPTVQLWHNIT
DLPNSQLGRINSLPYSLQQTSTYATTVGLEISSFFNNTSKKPTGVVDQVKAAGLQIHGWT
FRDDQLTWGNDSIDQYVIACQTLNITGIISEFPEAAISVAVMIRRQNEKIIAQI


>TTHERM_00701150(gene)
ATGGCAGCTTTAAAAATTTTGTTAGTAGCCATCCTTTTGTGTTCTGGATGTCTTAGTATT
AGTGTAACAAATAATACTACTTGGGACTACACAGTAGCTAAAAATAGACCTTTGGTAATT
GCTCATAGAGGTTATTCTTCTCTTTTCCCAGAAAACACTCTTGAAGCTTTCAGAGCTGCA
ATCTATGCTGGTGCTGATTTCTTTGAGTTAGATGTCCAAGTTACCAAAGATAACGTTCTT
TTAGTTTCTCATGATGCAACTCTTTCTCGTGTTACTGATGTTGCTAATAGAACTGAATTC
AAAAATAAGAAATCAACTAAATTGATTGATGGATAAAATGTCACTGATTGGTTTATTTGT
GACTTCACCCTTGCTGAAGTAAAAACCCTCAAAATTAAATAGGTATAACCAAATTTCTTG
CTAAATAACTAAATAAACATCTAATTATATTTATAATTTTGTGAGGCATAACATAATTTT
AATCAATTTAAGTTTTAAATATCATTTTATCTGCTAGTAAAGAAATGAAAATGCACATTT
TTGCACTTTTTAAACATAAAAAACTAGCTATATTAAATTAGTTTTTGAATAAATAAGAAA
AAAATAATTGAAATAACAATCAAAAAATATTGTAATTTACTGATAATAAAATTGATTAAG
AAATAGAAAAATAAAGATTAAATGTGATTGTTTTCAATTTTTAAAGAATAACTAAGATAC
TTCAAACATTTGGGTTAAATTATATTTATCCACAGTAGACTAATTAGTGAAGCAAATTAA
AAAATTATATTTTCAAATGAAATGTTTGTTTGAAATAATAAAATAAAATAAATATTTACC
CTATTTCTCCCTTTTAAAACATGAGGATTTAATATAAAAATTTAGAATATTTATAAATCT
TAAAATTAATATTCAATTTAAATATTTCCATGAGAATAATCTATAAGCTTAAAGAATGAT
TGCAGTGATATTATAAAGTATAATAAATACCATAAAACCATTTAAGATTAATATCAAATA
TTAATCAAAGAATAAAATAGCTTACTTTTCTCTCTATCTTTCAGAGTTTATTTGTGACTT
CTTAAATTACAATACGATTTTTAGAAATTTTAATCAACAAACTCTTTTACTAATTAAATT
AAATTTATTTTTTTAAAGAAATTTTATTGCCTCTACATTATTTTAGCTATAATTTTATTC
CTATTATCTTCTAAAATTTTATTATTTTTGAAATATCAGGTTTAAGTTTAAGGAAGAAAT
CAAGATTTGAACACCTATTTTACTTTCCCAAGCTTAAGAGAAACCATAGAAATGCTTATA
TAATTCAACTAACAACATTAAGGTAAAAGAAATCTTGATAATAGAATTGCAGGAGTAGTA
ATTGAATCTAAGGATAGAGATTTTTATCTTAATAATTATCACTTTGAGTAAGGAGCAAAA
ATTGTTGATTTACTCAGAGAGTTTAATTTACACACTATGTACAATGCTTCTATTTATGCC
CCTATTATATTGCACTCTTTTGATGCACCAACAGTCTAATTATGGCATAATATTACTGAC
TTACCTAACAGTTAACTTGGAAGAATCAATTCACTTCCTTATTCTCTCCAACAAACTAGT
ACATATGCCACTACAGTTGGTTTGGAAATTAGCTCATTCTTTAACAATACTTCCAAGAAA
CCCACTGGAGTTGTAGACTAAGTTAAAGCTGCTGGTTTATAAATACACGGTTGGACTTTC
AGAGATGATCAATTGACCTGGGGTAATGACAGTATTGATTAATACGTTATTGCTTGCCAA
ACTTTAAATATAACTGGTATTATTTCTGAATTCCCAGAAGCTGCTATCAGTGTCGCTGTT
ATGATACGTAGATAAAATGAAAAGATAATAGCTTAAATTTGA