Identifiers and Description

Gene Model Identifier

TTHERM_00522990

Standard Name

GCP5 (Gamma-tubulin Complex Protein 5)

Aliases

PreTt12414 | 65.m00232 | 3717.m00111

Description

Spc97/Spc98 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF04130 ) Spc97 / Spc98 family
  • ( PF05974 ) Protein of unknown function (DUF892)
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00522990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12803.19.997093137033517e-262Spc97/Spc98 family protein (13
62 aa)
OxytrichaContig12856.0.g889.995528898049344e-31Spc97 / Spc98 family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522990(coding)
ATGGCTACAAAACTAGAACCCGATTATAAAACTAGAATAGAAATATAAATTTAAACACTA
GTTAAAGGTTTAATTAGTTCCATGACTGATTTTGATGAAAATGATGAAAACTTTACTATA
GCCTTTGAATACATTATATCAAATATAAAAAATCATAGGTTCCTAACAGTTGATAAATTT
AGAGTAAAGCGAGAGTTAAATGGTTTACAAGAAAAGTTTGAGATACATCTTCAAAAGAAT
AAGTCTGAAAAATTGTAAAAATTAGTTGATAAATTTATGGAAAAAAAGCTAAAACCTCAT
GTGCCAGATATTCATTATTCAATCCTTCAGTTCTTGCTATTAATGTCAAATAATCCTATT
TCTTCACATTAAGAGGGAGATGATTTCGACAAAAAATATTAAGCAAATAAAGAAAAATTG
TAAACTTAATAAAGCTTTCAAGAATCTATGAAAGCTGCAGATCTTAAATTTCAAATTTAA
AATAATTAAATATTAGAAATGTAAAAGGCATTACTTTAAAAATATGATGAGGATTACGTT
TTTGAAAGCAGTAGTGAAGAAAGTGAGCTTGATGAAGAGGAATAGGACGAAAACGAACAA
GAAGAAATTGAAAATGTTTCAGGATTAAATAAAGAAGATAAAACAAAATATTTTAATAAA
AATTCAAATATATTTGAATAAAAAAAGTTTGATGTTTTTAGTAATGAGAATCAGTCAACT
AAAAAACAAGGAATAATAAAAAATATATCAAGCTTATCAAATGCAGATAAATCAGTTGAT
TAAAGCAAAATAGTTTCATTTAGAAATGCTAATGATTCTGGTATTCACCGCTAAAAGGAT
TCACTATTATAAGTTACTAACTTAAATTAAAACGATACGTATGATCAAGTAAAGTAATAG
AATGATAATGCTTCCAGTGTATATCTAAGAGGTATATAAACGAATTAATCTTTTTGGAAT
ATTACTCAATAAAGTATATTAAAGAAATCATCATTACAAAAGCGAAGCTATGAGGAATTC
CTCTCAGAATAAAAGAAGGAAGAAGAAAAGCAACTTTTTTTAGCAGCCAGATAATTTACT
AAGAATGATTTATTCAAAGATCCTAATAGTCTTGCTCAAATCTATGAAAATTATATCAAA
GAGAATTTAAGTAGGACTGTAAATACCTAGATAAGCTCAAACGGAGATTCCTAAATATAG
TTGAATCATTGGATATACTAAAATAAAACTGAGCGCTAAATTATATAGGATATAATTTTA
ATGCTTTAAAATTAACCAAGTTAAACCTTTGTGTTAGTTGATGAGCAGCCCCCATAATTT
AAGCTCAAAAAAAAGATATAAGTGAATCACCTAACACCTTCAACTCTTGAAAATATGATT
GATTGTTGCATAGATTTTGCAAATTAGCTATTAAAATTTTAGTTTTACAGAGAATAGTAT
GATAAATTAGAAATAGGAACTACTTTCTAAGCCTTTCTAGCCTCAATTCAGGCATTTTAC
TAATAATTCTAACAATTTTTAAATGCATTTCATTTAGTGTTTTTGCATCAATCTGCTTAA
ATAAAGAGAAATGAAATTTAAGTCACTCTTGAAGAAAAATATAAGTTCATGCTTGATAAG
ACTGTTTCTTTGATTGAATTATTTAAAGGTTTAAGGGAATATTAAATGGAGATGAGAATG
ATGATGAACACTTTAGAAGGAGCTATTGAGATATTTAAAAAGTAAAACTTGAAGGAACAA
AATACAGAAATGATTGATGAAAGTAATGCAAATTAACATGAGGATAATAAGAATGTTTAG
AGCTACATAGCTTGCTAAGTCATAGATTTTTTATATTTTTAGCTATAAATTAACAGTTAA
CATTATTGCTAGTACTCTCATTTATAATAACTGAACTGCTAGCTTTTTATACTTTCAATT
GAGCCTTATCTATCCATACTAAATGATTGGCTTCATGGTGGTTTTTTTTATGACAAATAC
TCTGAATTCTTTATAAAAAATAATATTAGAAACTAAAATTAGCAGTAGACATAATAGATT
TATTAGCATATTGATCATTAGATAAACTGGGTCAAGGATTTTTCGATTAGACTTTATCAA
GTAGAGTAATCTTAAAATAAAAGTGCCACTCCTTAATTTTTGTAAAAATTTGAGTAGACA
ATCCTTTAAATTGGTAAAAATGTAAGATTAATAGGGTATATTCTTAACGAGCATGATTAA
AGAGTATTTGTGGAACAAAAACTAAAAATTGAAGATATAAGAGAATAGATAAAAAACTAA
ATTTCTGAAGCTATTGAGAGGATAGATAAGAGCTAATAAAATTCTGTAGATATATGCAAT
GAAATACTAAAAAATAATTAGCAATAACCAGAAAAGTAAAATGTTTTAGACATTGAAAGT
GCATAAAATAAAAACTAAATTACATTATAATAAAATAATACACATCAATAAGATAAAACC
AAAGATTAGCCAAAGCAAATTTTAAAAAATTTGAGTATATCCTCAATATTAAAATAAAAG
AACTAATTCAAATAATAAAAAGAAAGAGATATCTTTTAGCTAAAAGAATAAACTCATAAT
TTCGATAAGAACTCTTTGCATTAATCAATTATTGTTGATGAAAATTAAATGTAGGAAGAA
TTAGATAATTCAAAAATTAAGGACAACCCTTTTAACATATTTACAATGAATCATAGTGAA
ATATTTAATTAGTCTGTGTTCACGATTTAAGATTCATTTTTAAATCAAGTTATTCCTGAG
CTTAAACAAATAAACACGAATGTAGTCTAAAAGAACGAGAAAGTCAACCTAAATAAAAAG
ATAAATTAGCTCCTAGATAAAAAAGGATTTACAAGCTAATTCATGAGGTTATTTGATTTA
TCAATAGAGTTTAGCATAAATTAAATGGATAGATAAGTTAAGAAATATTTAGGATCTATT
TTAATGAATGATTTTAAACTGTTAGAGCATTTTTAAGCTTTAAGGCATATTTATTTTATG
GAAAACGGATTTATAAGCACTGAATTTTTAAATTACTTATTTGATAACTTAGAAACTTAT
GATACACTGAAAAACTCATCTAGTTTAAAGAACTATTTCAAAGAGCTAATTACAAATTCA
AACTAGCCATTTATAAGAAATCTAAGTGAGTACTTTTCAATAGAAGTTCTTCATGATCCC
GTTAACACTTATCTAAAAAATTTAAAAATAAAATTCGATGCTCCTTACCCATTAGATGCG
ATATTCGATCAAGATTCTATATTCTTATATAATCATATATACTAGTTCTTACTCCTGTTA
AAAAAATCATAGCATTTCTTGCTTGACAAAAACTACTACTTGAAGAAAATGAGATTTTTT
GATGATTCTAGGATGAAGAATAAATTAAATTTATCTCAAAAAAAATAAAAAAATTTAAAA
TCCTAAAAAAATATTTATTCTGATTCTGATGATGATGAAATTTACAGAGGAAATAGCTAA
ATGGATGAAGAGGTAGACTTAGAAGAGTAAGCAAGGCTAAACAAGGAAATTAAAAACATA
AAATGGAAAATGTGTTTGCTTTAAAAATAATTTTTGAACTTTACTAATTCATTTTAATAT
TCAACTTTTGTAATTATAATTTAAGAAATTACATAGTAGTTTTTAAATGAAGTATCTTAA
GAATATAATATTGCAAGCTTTATTGATATGCACAAGCAATATTTAAAGAAGATAGCTGAC
TTATGTTTCCTTTCGAAAAAAACTGAAAATATTTTCCCAATTATATCAAGTCTTCTTAAA
TATTGCTGTGATTTTCATGCTTTAATTTAGAGACTTGAAGCAACCGAAACACTGGATTTA
TATACCATGAAGGGTGAATTATAAAGAATAAAGTCTGATTTTGCTTCCTTAAAATAAAAT
TTTGATAGACACAATATTCTAATAATCAGCTTTTTGTAGAAATATGGCGACATAGGACTA
AAATAAGAATGGGTCCCTCTTAATACAGCTTTAGACTTTAATAATTTTTACGTAAAAGAA
GATGAAAGAAAAAACTTGTTTGATAAAAATTTTTGA


>TTHERM_00522990(protein)
MATKLEPDYKTRIEIQIQTLVKGLISSMTDFDENDENFTIAFEYIISNIKNHRFLTVDKF
RVKRELNGLQEKFEIHLQKNKSEKLQKLVDKFMEKKLKPHVPDIHYSILQFLLLMSNNPI
SSHQEGDDFDKKYQANKEKLQTQQSFQESMKAADLKFQIQNNQILEMQKALLQKYDEDYV
FESSSEESELDEEEQDENEQEEIENVSGLNKEDKTKYFNKNSNIFEQKKFDVFSNENQST
KKQGIIKNISSLSNADKSVDQSKIVSFRNANDSGIHRQKDSLLQVTNLNQNDTYDQVKQQ
NDNASSVYLRGIQTNQSFWNITQQSILKKSSLQKRSYEEFLSEQKKEEEKQLFLAARQFT
KNDLFKDPNSLAQIYENYIKENLSRTVNTQISSNGDSQIQLNHWIYQNKTERQIIQDIIL
MLQNQPSQTFVLVDEQPPQFKLKKKIQVNHLTPSTLENMIDCCIDFANQLLKFQFYREQY
DKLEIGTTFQAFLASIQAFYQQFQQFLNAFHLVFLHQSAQIKRNEIQVTLEEKYKFMLDK
TVSLIELFKGLREYQMEMRMMMNTLEGAIEIFKKQNLKEQNTEMIDESNANQHEDNKNVQ
SYIACQVIDFLYFQLQINSQHYCQYSHLQQLNCQLFILSIEPYLSILNDWLHGGFFYDKY
SEFFIKNNIRNQNQQQTQQIYQHIDHQINWVKDFSIRLYQVEQSQNKSATPQFLQKFEQT
ILQIGKNVRLIGYILNEHDQRVFVEQKLKIEDIREQIKNQISEAIERIDKSQQNSVDICN
EILKNNQQQPEKQNVLDIESAQNKNQITLQQNNTHQQDKTKDQPKQILKNLSISSILKQK
NQFKQQKERDIFQLKEQTHNFDKNSLHQSIIVDENQMQEELDNSKIKDNPFNIFTMNHSE
IFNQSVFTIQDSFLNQVIPELKQINTNVVQKNEKVNLNKKINQLLDKKGFTSQFMRLFDL
SIEFSINQMDRQVKKYLGSILMNDFKLLEHFQALRHIYFMENGFISTEFLNYLFDNLETY
DTLKNSSSLKNYFKELITNSNQPFIRNLSEYFSIEVLHDPVNTYLKNLKIKFDAPYPLDA
IFDQDSIFLYNHIYQFLLLLKKSQHFLLDKNYYLKKMRFFDDSRMKNKLNLSQKKQKNLK
SQKNIYSDSDDDEIYRGNSQMDEEVDLEEQARLNKEIKNIKWKMCLLQKQFLNFTNSFQY
STFVIIIQEITQQFLNEVSQEYNIASFIDMHKQYLKKIADLCFLSKKTENIFPIISSLLK
YCCDFHALIQRLEATETLDLYTMKGELQRIKSDFASLKQNFDRHNILIISFLQKYGDIGL
KQEWVPLNTALDFNNFYVKEDERKNLFDKNF


>TTHERM_00522990(gene)
ATGGCTACAAAACTAGAACCCGATTATAAAACTAGAATAGAAATATAAATTTAAACACTA
GTTAAAGGTTTAATTAGTTCCATGACTGATTTTGATGTAATTTCTACTCACTCAATATTT
TATTATAAAAAACATGTTTATTAGAAGCATTCCTTTATTCTAATTTAGGAAAATGATGAA
AACTTTACTATAGCCTTTGAATACATTATATCAAATATAAAAAATCATAGGTTCCTAACA
GTTGATAAATTTAGAGTAAAGCGAGAGTTAAATGGGTAATACTTATTTACTTATGCTTAC
ATTTAATGGTTTTTATAAAATTAATTCCTAAAAAATACTTTAGTTTACAAGAAAAGTTTG
AGATACATCTTCAAAAGAATAAGTCTGAAAAATTGTAAAAATTAGTTGATAAATTTATGG
AAAAAAAGCTAAAACCTCATGTGCCAGATATTCATTATTCAATCCTTCAGTTCTTGCTAT
TAATGTCAAATAATCCTATTTCTTCACATTAAGAGGGAGATGATTTCGACAAAAAATATT
AAGCAAATAAAGAAAAATTGTAAACTTAATAAAGCTTTCAAGAATCTATGAAAGCTGCAG
ATCTTAAATTTCAAATTTAAAATAATTAAATATTAGAAATGTAAAAGGCATTACTTTAAG
TAATATTTTCTATTACTTATTTATTTTGCTAATAAAATATTTATTAAAAATTCAAAAGAA
ATATGATGAGGATTACGTTTTTGAAAGCAGTAGTGAAGAAAGTGAGCTTGATGAAGAGGA
ATAGGACGAAAACGAACAAGAAGAAATTGAAAATGTTTCAGGATTAAATAAAGAAGATAA
AACAAAATATTTTAATAAAAATTCAAATATATTTGAATAAAAAAAGTTTGATGTTTTTAG
TAATGAGAATCAGTCAACTAAAAAACAAGGAATAATAAAAAATATATCAAGCTTATCAAA
TGCAGATAAATCAGTTGATTAAAGCAAAATAGTTTCATTTAGAAATGCTAATGATTCTGG
TATTCACCGCTAAAAGGATTCACTATTATAAGTTACTAACTTAAATTAAAACGATACGTA
TGATCAAGTAAAGTAATAGAATGATAATGCTTCCAGTGTATATCTAAGAGGTATATAAAC
GAATTAATCTTTTTGGAATATTACTCAATAAAGTATATTAAAGAAATCATCATTACAAAA
GCGAAGCTATGAGGAATTCCTCTCAGAATAAAAGAAGGAAGAAGAAAAGCAACTTTTTTT
AGCAGCCAGATAATTTACTAAGAATGATTTATTCAAAGATCCTAATAGTCTTGCTCAAAT
CTATGAAAATTATATCAAAGAGAATTTAAGTAGGACTGTAAATACCTAGATAAGCTCAAA
CGGAGATTCCTAAATATAGTTGAATCATTGGATATACTAAAATAAAACTGAGCGCTAAAT
TATATAGGATATAATTTTAATGCTTTAAAATTAACCAAGTTAAACCTTTGTGTTAGTTGA
TGAGCAGCCCCCATAATTTAAGCTCAAAAAAAAGATATAAGTGAATCACCTAACACCTTC
AACTCTTGAAAATATGATTGATTGTTGCATAGATTTTGCAAATTAGCTATTAAAATTTTA
GTTTTACAGAGAATAGTATGATAAATTAGAAATAGGAACTACTTTCTAAGCCTTTCTAGC
CTCAATTCAGGCATTTTACTAATAATTCTAACAATTTTTAAATGCATTTCATTTAGTGTT
TTTGCATCAATCTGCTTAAAGTATCATTTTATATTAACATATTTTTTCTTTTCAAAAAAT
GTTCTATTAAAAATATAAAAAAATAGTAAAGAGAAATGAAATTTAAGTCACTCTTGAAGA
AAAATATAAGTTCATGCTTGATAAGACTGTTTCTTTGATTGAATTATTTAAAGGTTTAAG
GGAATATTAAATGGAGATGAGAATGATGATGAACACTTTAGAAGGAGCTATTGAGATATT
TAAAAAGTAAAACTTGAAGGAACAAAATACAGAAATGATTGATGAAAGTAATGCAAATTA
ACATGAGGATAATAAGAATGTTTAGAGCTACATAGCTTGCTAAGTCATAGATTTTTTATA
TTTTTAGCTATAAATTAACAGTTAACATTATTGCTAGTACTCTCATTTATAATAACTGAA
CTGCTAGCTTTTTATACTTTCAATTGAGCCTTATCTATCCATACTAAATGATTGGCTTCA
TGGTGGTTTTTTTTATGACAAATACTCTGAATTCTTTATAAAAAATAATATTAGAAACTA
AAATTAGCAGTAGACATAATAGATTTATTAGCATATTGATCATTAGATAAACTGGGTCAA
GGATTTTTCGATTAGACTTTATCAAGTAATTTACTTTTTCATATAATTTAGTTTGAAAAT
CTACATTTTAATCCTTTTTAAAAAAGGTAGAGTAATCTTAAAATAAAAGTGCCACTCCTT
AATTTTTGTAAAAATTTGAGTAGACAATCCTTTAAATTGGTAAAAATGTAAGATTAATAG
GGTATATTCTTAACGAGCATGATTAAAGAGTATTTGTGGAACAAAAAGTAAAAAAATAAA
TTAGCGAATTATAATATATTAAAAAATATTTTTATTAAAGCTAAAAATTGAAGATATAAG
AGAATAGATAAAAAACTAAATTTCTGAAGCTATTGAGAGGATAGATAAGAGCTAATAAAA
TTCTGTAGATATATGCAATGAAATACTAAAAAATAATTAGCAATAACCAGAAAAGTAAAA
TGTTTTAGACATTGAAAGTGCATAAAATAAAAACTAAATTACATTATAATAAAATAATAC
ACATCAATAAGATAAAACCAAAGATTAGCCAAAGCAAATTTTAAAAAATTTGAGTATATC
CTCAATATTAAAATAAAAGAACTAATTCAAATAATAAAAAGAAAGAGATATCTTTTAGCT
AAAAGAATAAACTCATAATTTCGATAAGAACTCTTTGCATTAATCAATTATTGTTGATGA
AAATTAAATGTAGGAAGAATTAGATAATTCAAAAATTAAGGACAACCCTTTTAACATATT
TACAATGAATCATAGTGAAATATTTAATTAGTCTGTGTTCACGATTTAAGATTCATTTTT
AAATCAAGTTATTCCTGAGCTTAAAGTAAGTTATATAAGTATTTTTTTGTATTTTTTTAT
ATGATTTTTAAAAAAAAGCAAATAAACACGAATGTAGTCTAAAAGAACGAGAAAGTCAAC
CTAAATAAAAAGATAAATTAGCTCCTAGATAAAAAAGGATTTACAAGCTAATTCATGAGG
TTATTTGATTTATCAATAGAGTTTAGCATAAATTAAATGGATAGATAAGTTAAGAAATAT
TTAGGATCTATTTTAATGAATGATTTTAAACTGTTAGAGCATTTTTAAGCTTTAAGGCAT
ATTTATTTTATGGAAAACGGATTTATAAGCACTGAATTTTTAAATTACTTATTTGATAAC
TTAGAAACTTATGATACACTGAAAAACTCATCTAGTTTAAAGAACTATTTCAAAGAGCTA
ATTACAAATTCAAACTAGCCATTTATAAGAAATCTAAGTGAGTACTTTTCAATAGAAGTT
CTTCATGATCCCGTTAACACTTATCTAAAAAATTTAAAAATAAAATTCGATGTAAAATTT
ATAATTAAAGGAATATTAAAAAATAAAAATTTTAACTTAGGCTCCTTACCCATTAGATGC
GATATTCGATCAAGATTCTATATTCTTATATAATCATATATACTAGTTCTTACTCCTGTT
AAAAAAATCATAGCATTTCTTGCTTGACAAAAAGTAAATTTTTCAAAAGTTTTATTTTTT
AAATTTACCTTTATTTTTTAAAAGCTACTACTTGAAGAAAATGAGATTTTTTGATGATTC
TAGGATGAAGAATAAATTAAATTTATCTCAAAAAAAATAAAAAAATTTAAAATCCTAAAA
AAATATTTATTCTGATTCTGATGATGATGAAATTTACAGAGGAAATAGCTAAATGGATGA
AGAGGTAGACTTAGAAGAGTAAGCAAGGCTAAACAAGGAAATTAAAAACATAAAATGGAA
AATGTGTTTGCTTTAAAAATAATTTTTGAACTTTACTAATTCATTTTAATATTCAACTTT
TGTAATTATAATTTAAGAAATTACATAGTAGTTTTTAAATGAAGTATCTTAAGAATATAA
TATTGCAAGCTTTATTGATATGCACAAGCAATATTTAAAGAAGATAGCTGACTTATGTTT
CCTTTCGAAAAAAACTGAAAATATTTTCCCAATTATATCAAGTCTTCTTAAATATTGCTG
TGATTTTCATGCTTTAATTTAGAGACTTGAAGCAACCGAAACACTGGATTTATATACCAT
GAAGGGTGAATTATAAAGAATAAAGTCTGATTTTGCTTCCTTAAAATAAAATTTTGATAG
ACACAATATTCTAATAATCAGCTTTTTGTAGAAATATGGCGACATAGGACTAAAATAAGA
ATGTAAATTAATAAATAACCTTAAATTAAGTTATGGAAATTATTTTTTAAAAATAGGGGT
CCCTCTTAATACAGCTTTAGACTTTAATAATTTTTACGTAAAAGAAGATGAAAGAAAAAA
CTTGTTTGATAAAAATTTTTGA